Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Vestalis gracilis (Rambur, 1842) — The Clear-Winged Forest Glory
Male
Female
- Suborder:
- Zygoptera
- Family:
- Calopterygidae
- Genus:
- Vestalis
- Species:
- Vestalis gracilis (Rambur, 1842)
- Common name:
- The Clear-Winged Forest Glory
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- All year round, High in June - August
- Local Distribution:
- Sylhet, Chittagong
- Global Distribution:
- Cambodia, India, Laos, Malaysia, Myanmar, Nepal, Thailand, Vietnam
- Identification Key:
- Two rows of cells between origins of Cuii and IA.
- Distinguishing Feature:
- Deep tinting of wings serves to separate V. gracilis from V. apicalis, some specimens of the former occasionally having the apices of the wings enfumed, and so being liable to be confused with the apicalis. V. gracilis and V. apicalis are frequently found in company, and taking pruinescence as a measure of full adulthood. Heavily pruinosed in which there is either no sign of apical darkening of the wings, or at the most a poorly defined shadow of such. These specimens are the true V. gracilis; similarly pruinosed specimens of apicalis found in their company have the apices of wings deep blackish-brown and very sharply defined.
- Abdomen Size:
- Male: 45.5 mm
Female: 46.5 mm - Wing Size:
- Male: 36 mm
Female: 37.5 mm - Wing Spot:
- Male: Absent
Female: Absent - Eye Color:
- Male: Dark brown greenish yellow
Female: Dark brown greenish yellow
- Description:
- The spectacular species often found perching in the green trees, hence making it difficult to sight and capture them.
- Male Description:
- The male is metalic green in color, the legs are long, black often pruinosed, eyes and thorax is green, thorax has yellow stripe, wings are transparent, abdomen slender, dark green in color.
- Female Description:
- The females are metalic green too, hence distinguishing females from males is not a simple task. However, females can be indentified by the swollen segments 9 and 10 and also by observing the anal appendages.
- COI Gene:
>gi|745791307|gb|KM675768.1| Vestalis gracilis cytochrome oxidase subunit I (CO1) gene, partial cds; mitochondrial
TGGTCAACAAATCATAAAGATATTGGAACCCTTTACCTGTTATTCGGAGCATGAGCAGGAATAGTAGGAACGGCCCTAAGAATGCTAATTCGAATTGAACTAGGACAACCGGGATCCCTTATTGGAGACGACCAAATCTACAACGTAGTAGTCACCGCCCATGCATTTGTAATAATCTTTTTTATAGTAATACCTATTATAATTGGGGGATTTGGAAATTGGCTTGTCCCACTAATGTTAGGGGCCCCTGATATGGCTTTCCCTCGACTAAACAACATGAGATTTTGACTTCTGCCCCCAGCATTAACTCTTCTATTAACAAGAAGTTTAGTAGAAAGAGGGGCTGGGACAGGTTGAACCGTATACCCTCCTCTAGCGGGGGCTATTGCTCACGCAGGAGGATCAGTAGATTTAACTATTTTCTCGCTTCACCTAGCAGGCGTATCCTCGATTTTAGGTGCCGTTAATTTCATTACTACAACAATTAATATAAAATCCCCTGGAATGAAGGCAGAGCAACTACCATTATTTGTTTGAGCAGTAGTAATTACAGCCATTTTGTTGCTATTATCATTACCCGTTCTGGCTGGAGCCATCACTATACTTTTAACAGACCGTAACATAAATACATCGTTCTTTGACCCTGCTGGGGGGGGAGACCCAATCCTTTATCAACATTTATTT
- CO1 Protein:
>tr|A0A0B4VSQ4|A0A0B4VSQ4_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Vestalis gracilis GN=CO1 PE=3 SV=1
WSTNHKDIGTLYLLFGAWAGMVGTALSMLIRIELGQPGSLIGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPALTLLLTSSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAVNFITTTINMKSPGMKAEQLPLFVWAVVITAILLLLSLPVLAGAITMLLTDRNMNTSFFDPAGGGDPILYQHLF