Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Trithemis pallidinervis (Kirby, 1889) — Long-Legged Marsh Glider
.jpg){kind=link}
Male
.jpg){kind=link}
Male
Male
Female
.jpg){kind=link}
Female
.jpg){kind=link}
Female
Female
Female
Female
Female
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Trithemis
- Species:
- Trithemis pallidinervis (Kirby, 1889)
- Common name:
- Long-Legged Marsh Glider
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- Rangpur, Dhaka, Sylhet, Chittagong, Khulna
- Global Distribution:
- Bangladesh, Cambodia, Hong Kong, India, Indonesia, Iran, Laos, Malaysia, Myanmar, Nepal, Oman, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Legs very long and spidery; pterostigma bicolorous; body yellow marked with black.
- Distinguishing Feature:
- The hind femora extending to end of segment 2 instead of only to end of thoras as in all other species, the armature of the hind femora is similar to other species, but differs by being the same in both sexes, the wings differ by a slightly differently shaped anal loop and the bicolorous pterostigma. It is quite the largest species of the genus Trithemis. Variabihty does not exist and unlike other species of the same genus, the sexes are alike.
- Abdomen Size:
- Male: 30 mm
Female: 27 mm - Wing Size:
- Male: 33 mm
Female: 31 mm - Wing Spot:
- Male: Black with white ends
Female: Black with white ends - Eye Color:
- Male: Reddish brown bluish grey
Female: Reddish brown bluish grey
- Description:
- As the common name suggests, long-legged marsh glider, has long legs that are black in color. The head is pinkish. The thorax is brownish, wings are transparent, pterostigma black, amber in the base of wings. Abdominal segments are black with white dorsal bands, Segments 8-10 are completely black, base of the anal appendages are white while tips are black.
- Female Description:
- The females are very similar to males. Head is more greenish than male, also the thorax is more yellowish. Anal appendages are a good way to distinguish female from male. Anal appendages are white.
- COI Gene:
>gi|631230023|gb|KJ499455.1| Trithemis pallidinervis voucher MZDF16 cytochrome oxidase subunit 1 gene, partial cds; mitochondrial
ATTTTCGGTGCTTGAGCCGGAATAATTGGTACTGCTCTAAGTGTTTTAATTCGAATTGAATTAGGTCAACCTGGATCTCTAATTGGAGATGATCAAATTTATAATGTTATTGTAACTGCCCATGCATTTGTAATAATTTTCTTCATGGTTATACCTATTATAATTGGTGGATTTGGTAATTGACTAGTGCCATTAATGTTAGGTGCACCAGATATAGCATTTCCACGACTTAATAATATAAGTTTTTGATTATTACCTCCTTCATTTACACTTCTTCTAGCTAGAAGTATAGTTGAAAGTGGAGCAGGAACAGGATGAACTGTTTATCCTCCTCTAGCTGGAGCTATTGCCCATGCAGGAGCATCCGTAGATTTAACTATTTTCTCATTACATTTGGCTGGAGTATCTTCCATTTTAGGGGCTATTAATTTTATTACTACAGTAATTAATATAAAATCTCCTGGAATAAAATTAGATCAAATACCATTATTTGTATGAGCTGTAGTAATTACAGCAGTTCTATTATTATTATCATTACCAGTATTAGCAGGTGCTATTACCATACTATTAACTGATCGTAATATTAATACATCATTTTTTGACCCTGCAGGGGGAGGAGATCATAATTTATATCAACA
- CO1 Protein:
>tr|A0A024B5F3|A0A024B5F3_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Trithemis pallidinervis PE=3 SV=1
IFGAWAGMIGTALSVLIRIELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDHNLYQ