Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Aristocypha quadrimaculata (Selys, 1853) — Black Emperor
Male
Male
Male
Male
Female
- Suborder:
- Zygoptera
- Family:
- Chlorocyphidae
- Genus:
- Aristocypha
- Species:
- Aristocypha quadrimaculata (Selys, 1853)
- Common name:
- Black Emperor
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- May - July, October - December
- Local Distribution:
- Sylhet, Chittagong
- Global Distribution:
- Bangladesh, India, Myanmar, Nepal, Thailand
- Abdomen Size:
- Male: 25 mm
Female: 21 mm - Wing Size:
- Male: 27 mm
Female: 31 mm - Wing Spot:
- Male: Black with white edge
Female: Black with yellowish edge - Eye Color:
- Male: Black
Female: Brownish black fading to bluish grey
- Description:
- Aristocypha quadrimaculata is one of the spectacular damselflies found in the waterfalls of the north east and south east regions of Bangladesh.
- Male Description:
- The males are black in color. The head, abdominal segments, anal appendages and legs are black. Thorax black with yellow stripes. More than half of the apical parts of the wings are opaque with violet stripes in the hind wings.
- Female Description:
- The females are black in color too. The head is black, thorax is black with yellow stripe. abdominal segments has yellow color laterally. Wings are transparent, pterostigma and legs are black.
- COI Gene:
>MN531349.1 Aristocypha quadrimaculata isolate RD1 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial
CATGCATTTATCATAATTTTTTTCATAGTAATACCTATTATAATTGGTGGGTTTGGAAACTGACTAGTTCCATTAATACTTGGAGCACCAGATATAGCATTTCCACGCATAAACAACATAAGATTTTGATTACTACCTCCCTCATTAACCTTACTATTGTCAAGAAGATTAGTAGAAAGAGGAGCAGGAACAGGGTGAACAGTCTATCCTCCATTAGCAGGGGCTATTGCCCATGCAGGAGGATCTGTAGACCTTACAATTTTTTCACTACACTTGGCAGGAGTTTCATCCATCTTGGGAGCCATTAATTTCATCACAACTACTATTAACATAAAACCACCCGGAATAAAAATAGATCAATTACCTTTATTCGTATGAGCTGTGGTTATTACAGCAGTATTACTACTACTATCCCTACCAGTTTTAGCAGGAGCTATTACAATACTATTAACAGATCGTAACATCAATACATCTTTTTTTGACCCAGCAGGTGGTGGGGATCCAAT
- CO1 Protein:
>QGT51796.1 cytochrome oxidase subunit 1, partial (mitochondrion) [Aristocypha quadrimaculata]
HAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTTINMKPPGMKMDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDP