Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Neurothemis tullia (Drury, 1773) — Pied Paddy Skimmer
Male
Male
.jpg){kind=link}
Male
Male
Female
Female
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Neurothemis
- Species:
- Neurothemis tullia (Drury, 1773)
- Common name:
- Pied Paddy Skimmer
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, China, Hong Kong, India, Malaysia, Myanmar, Nepal, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Black basal area of wings edged outwardly with an opalescent white band.
- Distinguishing Feature:
- There is no difficulty in distinguishing this subspecies from others of the same genus. The black base of wings with opalescent white outer bordering is very characteristic, whilst, in the females, the broad black apices of wings and sickle-shaped stripe on basal half are equally diagnostic.
- Abdomen Size:
- Male: 18 mm
Female: 17.5 mm - Wing Size:
- Male: 21 mm
Female: 21.5 mm - Wing Spot:
- Male: Dull brown
Female: Dull brown - Eye Color:
- Male: Pale brown above olivaceous below
Female: Paler
- Male Description:
- The males are black and white in color. Head, prothorax, thorax and abdominal segments are black. Wings are black from base till node, white band present in the nodus region, from there till the tip of the wing is transparent, pterostigma black.
- Female Description:
- The females are also black and white in color. A white band travels from the prothorax, to thorax and reaches till segment 9. Segment 10 is black, anal appendages are white. The tips of the wing is black, also black stripe is present in the nodal region.
- COI Gene:
>gi|440656307|gb|KC122229.1| Neurothemis tullia voucher MZDF10 cytochrome oxidase subunit 1 gene, partial cds; mitochondrial
ATTCGAATTGAGTTAGGGCAGCCAGGCTCACTAATTGGTGATGACCAGATTTATAATGTGATTGTTACTGCCCACGCCTTTGTAATAATTTTCTTTATGGTTATGCCAATTATAATTGGTGGGTTCGGTAACTGRCTGGTCCCATTAATGCTTGGGGCACCAGACATGGCCTTCCCACGACTTAATAATATAAGATTTTGACTTCTACCTCCTTCATTCACTTTACTTTTAGCTAGAAGTATGGTTGAAAGAGGGGCAGGGACAGGGTGAACAGTTTATCCACCTCTAGCGGGGGCTATTGCACATGCAGGAGCATCTGTAGATTTAACAATTTTTTCTCTTCATTTGGCGGGGGTTTCCTCAATTTTAGGTGCTATCAATTTTATTACAACAGTAATTAATATAAAGTCCCCCGGGATGAAGTTAGATCAAATACCTCTATTTGTATGAGCAGTAGTAATTACTGCAGTACTTCTTCTCCTATCCTTGCCAGTTCTTGCCGGAGCTATTACTATACTATTAACTGACCGAAATATTAATACATCATTCTTTGATCCTGCAGGTGGTGGAGATCCAATTTTATATCAACATTTATTCTGATTTTTT
- CO1 Protein:
>tr|L7SS69|L7SS69_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Neurothemis tullia PE=3 SV=1
IRIELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFF