Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Trithemis aurora (Burmeister, 1839) — Crimson Marsh Glider
.jpg){kind=link}
Female
.jpg){kind=link}
Male
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Trithemis
- Species:
- Trithemis aurora (Burmeister, 1839)
- Common name:
- Crimson Marsh Glider
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- March - November
- Local Distribution:
- Dhaka, Sylhet, Chittagong
- Global Distribution:
- Bangladesh, Brunei Darussalam, Cambodia, China, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Myanmar, Nepal, Pakistan, Philippines, Singapore, Sri Lanka, Thailand, Timor-Leste, Vietnam
- Identification Key:
- Thorax and abdomen violaceous-crimson; base of hind-wing with small reddish-brown spot; neuration crimson.
- Distinguishing Feature:
- The almost general violaceous coloring of the male will serve to determine it from all other species of the genus, the only other dragonfly with which it is likely to be confused is O. pruinoswm with the same colouring, which, however, is very much larger and has the discoidal field of fore-wing markedly dilated at wing-border and the posterior lobe of prothorax much enlarged.
- Abdomen Size:
- Male: 25 mm
Female: 23 mm - Wing Size:
- Male: 29 mm
Female: 24 mm - Wing Spot:
- Male: Dark reddish brown
Female: Reddish brown - Eye Color:
- Male: Crimson above brown on side
Female: Pale brown
- Description:
- Trithemis aurora is very common, in fact, it is the most abundant dragonfly in the hilly regions of Chittagong. Sighting occurances were significantly higher in khagrachari, near waterfalls.
- Male Description:
- The juvenile male are orange in color, the hind wing base has dark orange patch. The veins are orange, wing transperant, pterostigma black. The adults are spectacularly colorful insects with scintillating reddish-pink color. The thorax and head is magenta in color, wing transparent, veins reddish. Legs are black, anal appendages anterior red, posterior black.
- Female Description:
- The females are less abundant than males and prefer to stay away from the waterbodies except their breeding period. The females are like juvenile male and can be distinguished by looking at their anal appendages.
- COI Gene:
>gi|391352955|dbj|AB709236.1| Trithemis aurora mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1296
ATTAGTACCATTAATATTAGGGGCACCAGATATAGCATTCCCACGTCTAAATAATATAAGATTTTGACTTCTCCCACCATCATTTACGTTATTACTAGCAAGAAGAATAGTAGAAAGAGGAGCAGGAACAGGATGAACAGTTTATCCTCCTCTTGCAGGAGCAATTGCTCATGCTGGAGCATCTGTAGACTTAACTATTTTTTCTTTACATCTTGCAGGAGTTTCATCAATTTTAGGTGCTATCAATTTTATTACAACAGTAATTAATATAAAATCTCCAGGTATGAAACTAGATCAATTACCTCTATTTGTATGAGCCGTAGTAATTACAGCAGTACTATTATTATTATCACTACCAGTACTAGCGGGGGCAATTACAATATTATTAACAGATCGTAATATTAATACATCATTCTTCGATCCTGCAGGTGGAGGAGACCCAATTTTATAT
- CO1 Protein:
>tr|Q3LV99|Q3LV99_9ODON Cytochrome c oxidase subunit 2 OS=Trithemis aurora GN=COII PE=3 SV=1
MATWAQLNFQDASSPMMEQLHYFHDHTMMVLVIITIMVAYIMGAMFINMDINRNLLDGQKIETAWTILPVFVLVIIAMPSLRLLYLLDEVSEPSITLKTVGHQWYWSYEYSDFKHVEFDSYMTPYSEMENNGFRLLEVDNRTTLPMQTQVRVLVTAADVLHSWTVPSLGVKVDATPGRLNQTSFFINRPGVFFGQCSEICGANHSFMPIMIESVNIKSFINWIQNMSEA