Rhyothemis triangularis (Kirby, 1889) — Sapphire Flutterer, Lesser Blue Wing
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Rhyothemis
- Species:
- Rhyothemis triangularis (Kirby, 1889)
- Common name:
- Sapphire Flutterer, Lesser Blue Wing
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- April - September, November
- Local Distribution:
- Sylhet, Chittagong
- Global Distribution:
- Brunei Darussalam, China, Hong Kong, India, Indonesia, Malaysia, Philippines, Singapore, Sri Lanka, Thailand
- Identification Key:
- Two rows of cells between IRiii and Rspl; base of wings deep black, with steely blue reflex, up to discoidal cell in forewing, and nearly to node in the hindwing.
- Distinguishing Feature:
- The limitation of the opaque black area to base of the wings distinguish this species from R. plutonia and other black winged species.
- Abdomen Size:
- Male: 18 mm
Female: 16.5 mm
- Wing Size:
- Male: 26.5 mm
Female: 26 mm
- Wing Spot:
- Male: Dark reddish brown
Female: Similar
- Eye Color:
- Male: Blackish-brown above, paler brown below
Female: Similar
- COI Gene:
>MG885338.1 Rhyothemis triangularis isolate OA-12 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial
ACTAGCAGGAGCAATTGCTCATGCTGGGGCATCAGTAGATTTAACTATTTTTTCGTTACATTTAGCAGGAGTATCATCAATTCTAGGAGCTATTAATTTTATCACTACAGTGATTAATATAAAGTCACCGGGTATAAAAATAGATCAAATACCTTTATTTGTATGAGCCGTAGTAATTACAGCTGTATTACTACTATTATCATTACCTGTTTTAGCAGGAGCTATTACTATACTTCTAACTGATCGAAATATTAATACATCATTTTTTGATCCGGCAGGAGGAGGTGATCCTATTCTTTATCAACATTTATTT
- CO1 Protein:
>AWX25678.1 cytochrome oxidase subunit I, partial (mitochondrion) [Rhyothemis triangularis]
LAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF