Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Tholymis tillarga (Fabricius, 1798) — Coral-Tailed Cloudwing
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Tholymis
- Species:
- Tholymis tillarga (Fabricius, 1798)
- Common name:
- Coral-Tailed Cloudwing
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- American Samoa, Angola, Australia, Bangladesh, Benin, Botswana, Brunei Darussalam, Burkina Faso, Cambodia, Cameroon, Chad, China, Comoros, Congo, Cook Islands, Equatorial Guinea, Ethiopia, French Polynesia, Gabon, Gambia, Ghana, Guam, Guinea, Hong Kong, India, Indonesia, Ivory Coast, Japan, Kenya, Kiribati, Laos, Liberia, Madagascar, Malawi, Malaysia, Mali, Mauritius, Micronesia, Mozambique, Myanmar, Namibia, Nepal, New Caledonia, Nigeria, Northern Mariana Islands, Pakistan, Palau, Papua New Guinea, Philippines, Samoa, Senegal, Seychelles, Sierra Leone, Singapore, Solomon Islands, Somalia, South Africa, South Sudan, Sri Lanka, Tanzania, Thailand, Timor-Leste, Togo, Uganda, Vietnam, Zambia, Zimbabwe
- Distinguishing Feature:
- The brown fascia and opalescent white spot on hind-wing will serve to identify it from all other species of Odonata.
- Abdomen Size:
- Male: 30.5 mm
Female: 29 mm - Wing Size:
- Male: 35 mm
Female: 34 mm - Wing Spot:
- Male: Reddish brown
Female: Reddish brown - Eye Color:
- Male: Reddish olive with brown cap
Female: Paler
- Description:
- The coral-tailed cloudwing is one of the beautiful Libellulidae species found in Bangladesh. Unlike many dragonflies they are mostly active in the late afternoon or before sunset, they fly even mate in that period.
- Male Description:
- The male is red in color. They can be clearly distinguished from the other closely similar species by observing the cloud like patches in the hind wing. In fact their common name cloud wing came from their cloudy patches. The juvenile male is yellow in color, closely similar to female. Yellow patches present in the hind wing, cloudy patches are yet to be formed. Juvenile male can be confirmed by checking the Libellulidae species anal appendages and also the segments 9-10 are constrained.
- Female Description:
- The females are similar to juvenile males. Ground color yellow, yellow patches present in the hind wing, the abdominal segments 9-10 are dilated, anal appendages are well spread.
- COI Gene:
>gi|391352875|dbj|AB709196.1| Tholymis tillarga mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1357
ATTAGTACCATTAATATTGGGAGCCCCTGATATGGCATTTCCACGATTAAATAATATAAGATTCTGACTCCTACCGCCTTCTTTTACCCTTCTTCTAGCTAGAAGAATAGTAGAAAGAGGTGCAGGTACAGGATGAACAGTTTATCCCCCATTAGCAGGAGCCATTGCTCATGCAGGAGCATCTGTAGATTTAACCATTTTTTCACTACACTTAGCGGGAGTGAGATCTATTCTGGGTGCAATTAACTTTATTACTACAGTAATTAATATAAAATCACCAGGAATAAAAATAGATCAAATACCTTTATTTGTATGAGCCGTAGTAATTACTGCTGTACTGTTACTATTATCCCTTCCTGTTCTAGCAGGAGCTATTACCATACTATTGACTGACCGAAATATTAATACATCATTCTTTGACCCTGCAGGGGGAGGAGATCCAATTTTATAT
- CO1 Protein:
>tr|I4DX28|I4DX28_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Tholymis tillarga GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY