Odonata of Bangladesh

List of Species

Libellago lineata (Burmeister, 1839) — River Heliodor

Female

Male

Others

Suborder:: Zygoptera
Family:: Chlorocyphidae
Genus:: Libellago
Species:: Libellago lineata (Burmeister, 1839)

Common name:: River Heliodor
Global IUCN status:: Least Concern

Eco-system:: Terrestrial, Freshwater
Abundance:: Common in stream
Flight Seasons:: All year round, High in June - August
Local Distribution:: Sylhet, Chittagong
Global Distribution:: China, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Thailand, Vietnam

Abdomen Size:: Male: 15 mm
Female: 15 mm
Wing Size:: Male: 16.5 mm
Female: 18.5 mm
Wing Spot:: Male: Absent in forewing & black in hindwing
Female: Creamy white
Eye Color:: Male: Dark brown above grey below
Female: Brown above grey below

Description:: Libellago lineata is one of the common damselflies species found in the stream of the north east and south east regions of Bangladesh.
Male Description:: Males are yellow and black, wings are transparent with black tip. Legs are black, abdominal segments 1-8 are yellow with black dorsal and lateral black patch, Segment 9-10 and anal appendages are black. They are common in the hilly streams.
Female Description:: The females are yellow with dorsal and lateral black patches. Wings are transparent. Unlike males, the tips are clear.

COI Gene:

>MN271674.1 Libellago lineata isolate Lib cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial

TACCTACTATTTGGAGCATGAGCAGGGATAGTAGGAACAGCCTTGAGAATATTAATCCGAGTAGAACTCGGACAACCAGGTACATTAATTGGAGATGATCAGATTTATAATGTAGTAGTAACTGCCCATGCATTTATCATAATTTTTTTTATAGTTATACCTATTATAATCGGAGGATTTGGGAATTGATTGGTTCCATTAATACTTGGAGCACCAGATATAGCATTTCCTCGTATAAATAACATAAGATTTTGATTACTTCCTCCATCATTATCCTTACTTCTTTCTAGAAGTTTAGTAGAAAGTGGTGCAGGCACTGGGTGGACCGTTTACCCTCCTCTAGCAGGGGCTATTGCTCACGCCGGAGGGTCTGTAGATCTAACGATCTTTTCACTACATTTAGCAGGAGTATCATCAATCTTAGGGGCCATCAACTTCATTACAACTACTATTAATATAAAAGCTCCAGGGATAAAAATAGATCAAATGCCCTTATTTGTGTGGGCAGTCATCATTACAGCAGTATTACTATTACTTTCCCTACCAGTACTAGCCGGTGCTATTACAATACTATTAACTGATCGAAATATTAATACTTCCTTTTTCGACCCTGCAGGAGGGGGGGACCCTATTTTATATCAACATTTATTT

CO1 Protein:

>QGT51780.1 cytochrome oxidase subunit 1, partial (mitochondrion) [Libellago lineata]

YLLFGAWAGMVGTALSMLIRVELGQPGTLIGDDQIYNVVVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLLSSSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTTINMKAPGMKMDQMPLFVWAVIITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF

Copyright © 2020-2022, All Rights Reserved. Odonata of Bangladesh holds copyright for all the original material and compilations on this website, although contributing writers and photographers may hold copyright for their material. Material from this website can be used freely for educational, basic research and conservation purposes, provided that this website is acknowledged and properly cited as the source. Contact us to obtain prior permission for any other use.