Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Anax guttatus (Burmeister, 1839) — Lesser Green Emperor
/1. -0017.jpg){kind=link}
Female
/1. -0035.jpg){kind=link}
Female
/3. -0042.jpg){kind=link}
Female
/Anax guttatus_male (Photo by Arunavo Bruno).jpg){kind=link}
Male
- Suborder:
- Anisoptera
- Family:
- Aeshnidae
- Genus:
- Anax
- Species:
- Anax guttatus (Burmeister, 1839)
- Common name:
- Lesser Green Emperor
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- March - November
- Local Distribution:
- Rajshahi, Dhaka, Sylhet, Chittagong, Khulna
- Global Distribution:
- Australia, Bangladesh, Brunei Darussalam, China, Cook Islands, Hong Kong, India, Indonesia, Japan, Kiribati, Laos, Malaysia, Marshall Islands, Micronesia, Myanmar, Nepal, Papua New Guinea, Philippines, Seychelles, Singapore, Sri Lanka, Thailand, Timor-Leste, United States, Vietnam
- Identification Key:
- Thorax pale green, or bluish-green or pale brown without any broad black markings. Frons without a black T-shaped spot. Abdomen with orange colored markings.
- Distinguishing Feature:
- Specimens from wet areas show considerable restriction of the light-coloured markings of the abdomen, whilst those from dryer zones show a corresponding increase in these markings. There is also a slight difference to be noted in the shape of the appendages, but this appears to be less restricted to definite areas. It breeds in small weedy tanks and jhils, and may be found hawking around the borders of these, never wandering away from water.
- Abdomen Size:
- Male: 59 mm
Female: 53 mm - Wing Size:
- Male: 52 mm
Female: 43 mm - Wing Spot:
- Male: Reddish
Female: Reddish - Eye Color:
- Male: Blue with yellow and black behind
Female: Blue with yellow and black behind
- COI Gene:
>gi|391351681|dbj|AB708599.1| Anax guttatus mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF739
GTTAGTACCACTAATATTAGGAGCACCTGATATAGCCTTCCCACGATTAAATAATATAAGATTTTGATTATTACCTCCTTCTCTTACACTTTTATTAGCAGGAAGTATAGTTGAAAGAGGTGCTGGAACAGGATGAACAGTTTATCCTCCTCTTGCCGGTGCAATTGCTCATGCAGGAGCATCTGTAGATTTAACTATTTTTTCTCTTCATTTAGCAGGTGTATCTTCAATTTTAGGTGCTATTAATTTTATTACTACAACAATTAATATAAAGTCACCAGGAATAAAGATAGATCAAATACCATTATTTGTATGAGCTGTAGTAATTACAGCTGTATTATTATTATTGTCTCTTCCTGTTCTTGCCGGTGCAATTACAATATTATTAACAGATCGAAATATTAATACATCATTCTTTAATCCTGCAGGAGGGGGTGATCCAATTTTATAT
- CO1 Protein:
>tr|I4DVD0|I4DVD0_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Anax guttatus GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLAGSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFNPAGGGDPILY