Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Lathrecista asiatica (Fabricius, 1798) — Asiatic Blood Tail
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Lathrecista
- Species:
- Lathrecista asiatica (Fabricius, 1798)
- Common name:
- Asiatic Blood Tail
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- All year round
- Local Distribution:
- Dhaka, Sylhet, Chittagong, Khulna, Barisal
- Global Distribution:
- Australia, Bangladesh, Brunei Darussalam, China, India, Indonesia, Laos, Malaysia, New Caledonia, Papua New Guinea, Philippines, Samoa, Singapore, Thailand, Vietnam
- Distinguishing Feature:
- This species is closely allied to A. insignis and N. lineata by the yellow spots behind head, which are borne by all species of these genera, but it is easily distinguished from them by the great length of the anal loop, and the female by the characteristic shape of the genitalia.
- Abdomen Size:
- Male: 29.5 mm
Female: 29.5 mm - Wing Size:
- Male: 35 mm
Female: 35 mm - Wing Spot:
- Male: Reddish brown
Female: Reddish brown - Eye Color:
- Male: Brown above & bluish grey below
Female: Brown above & bluish grey below
- COI Gene:
>gi|391352421|dbj|AB708969.1| Lathrecista asiatica mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1110
ATTAGTACCTTTAATATTAGGAGCACCCGATATAGCATTCCCACGTCTTAATAATATAAGATTTTGATTATTACCTCCATCATTTACATTATTACTAGCAAGTAGTATAGTTGAAAGAGGTGCAGGAACCGGATGAACAGTTTATCCTCCACTAGCAGGAGCAATTGCACACGCTGGAGCATCTGTAGATTTAACTATTTTCTCATTACACCTTGCAGGAGTATCTTCAATTCTAGGTGCAATCAACTTTATTACAACAGTAATTAATATAAAGTCACCTGGAATAAAAATAGATCAATTGCCATTATTTGTATGAGCAGTAGTAATTACGGCAGTATTACTACTTTTATCTTTACCAGTATTAGCAGGAGCTATTACTATACTATTAACAGACCGAAATATTAATACATCCTTCTTTGATCCTGCAGGAGGAGGAGACCCTATTTTATAT
- CO1 Protein:
>tr|I4DWF2|I4DWF2_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Lathrecista asiatica GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY