Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Diplacodes nebulosa (Fabricius, 1793) — The Black-Tipped Ground Skimmer
Male
.jpg){kind=link}
Male
.jpg){kind=link}
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Diplacodes
- Species:
- Diplacodes nebulosa (Fabricius, 1793)
- Common name:
- The Black-Tipped Ground Skimmer
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- All year round
- Local Distribution:
- Rangpur, Dhaka, Sylhet, Chittagong, Khulna, Barisal
- Global Distribution:
- Australia, Bangladesh, Cambodia, China, Hong Kong, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Papua New Guinea, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Apices of wings tipped with black.
- Distinguishing Feature:
- It is closely related to D. lefebvrei, and teneral forms can hardly be distinguished from one another, although the differences become increasingly broad as adult age is reached. The males are distinguished by the sharply limited dark area at the apices of wings in the cases of nebulosa, contrasted with the pale diffuse enfumation in lefebvrei, the females by the creamy-white face and frons quite unmarked with black or brown, even in the case of adults.
- Abdomen Size:
- Male: 16 mm
Female: 14.5 mm - Wing Size:
- Male: 18 mm
Female: 18 mm - Wing Spot:
- Male: Black
Female: Black - Eye Color:
- Male: Coffee brown greyish yellow
Female: Reddish brown
- Description:
- Currently, two Diplacodes species are known from Bangladesh. Unlike Diplacodes trivialis, Diplacodes nebulosa is not very common. The two species are similar. However can be easily distinguish by the black wing tip of D. nebulosa male.
- COI Gene:
>gi|444300741|gb|KC287155.1| Diplacodes nebulosa voucher MZDF22 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial
ATTGAATTAGGACAGCCAGGAGCATTAATTGGAGATGATCAAATTTATAATGTAAATGTCGCTGCCCATGCATTTGTGATGATTTTCTTGATGGCAATGCCTATTATAATTGGAGGTTTTGGAAATTGACTTGTACCACTAATATTAGGAGCACCTGACATGGCATTTCCACGACTAAATAACATAAGATTTTGATTACTTCCACCCTCGTTTACATTACTACTAGCTAGTAGTATGGTGGAAAGAGGAGCGGGAACCGGATGAACAGTTTATCCACCTCTAGCAGGAGCCATTGCACATGCAGGAGCTTCAGTGGACTTAACTATTTTCTCATTACACCTTGCCGGTGTTTCTTCGATTCTTGGTGTTATCAATTTTATTACAACAGTAATTAATATGAAGTCACCAGGTATAAAATTAGATCAAATACCATTATTTGTATGAGCAGTAGTAATTACTGCAGTACTACTTCTATTATCTTTCCCTGTACTAGCAGGAGCTATTACAATACTATTAACCGATCGAAATATTAACACTTCATTTTTTGACCCAGCAGGGGGAGGAGATCCAATTTTATACCAACATTTATTT
- CO1 Protein:
>tr|L7YE96|L7YE96_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Diplacodes nebulosa GN=COI PE=3 SV=1
IELGQPGALIGDDQIYNVNVAAHAFVMIFLMAMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGVINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSFPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF