Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Brachythemis contaminata (Fabricius, 1793) — Ditch Dewel
Female
Female
Male
Male
Others
Others
Others
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Brachythemis
- Species:
- Brachythemis contaminata (Fabricius, 1793)
- Common name:
- Ditch Dewel
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, Cambodia, China, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Myanmar, Nepal, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Abdomen Size:
- Male: 19.5 mm
Female: 19 mm - Wing Size:
- Male: 21.5 mm
Female: 23.5 mm - Wing Spot:
- Male: Rusty brown
Female: Yellowish - Eye Color:
- Male: Pale brown & bluish grey
Female: Pale brown
- Description:
- This dragonfly is one of the most abundant dragonflies of Bangladesh.
- Male Description:
- In males, the length of the abdomen ranges from 21-23 mm, red colored. The head is brown, wings transparent, reddish amber extends over the nodal area, pterostigma red. Legs black. Abdominal segments are red, black dorsal stripe present in the abdominal segments. Caudal appendages are reddish.
- Female Description:
- Females are similar in size and shape of males, and are bright colored. Unlike males, their wings are completely transparent, pterostigma yellow. Bold, black dorsal stripe present throughout the abdomen. Females can be easily identified by their distinguished anal appendages.
- COI Gene:
>gi|391352381|dbj|AB708949.1| Brachythemis contaminata mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1335
ATTAGTACCATTAATGTTAGGGGCACCTGATATGGCTTTCCCCCGACTTAATAATATAAGATTTTGATTACTACCACCATCATTTACTTTACTTCTTGCAAGAAGTATAGTTGAAAGAGGGGCAGGAACAGGATGAACAGTTTACCCACCATTAGCAGGGGCTATTGCCCATGCCGGTGCATCAGTTGATTTAACAATTTTCTCCTTGCACCTAGCCGGAGTAAGTTCAATTCTAGGAGCAATTAATTTTATTACTACCGTAATTAATATAAAATCACCAGGAATGGGTATAGAACAAATACCCTTATTCGTATGAGCAGTAGTAATTACAGCAATTCTTTTACTATTATCTTTGCCAGTACTAGCAGGAGCTATTACCATACTACTAACAGACCGAAATATTAATACATCATTTTTTGATCCTGCGGGGGGAGGAGATCCAATCTTATAT
- CO1 Protein:
>tr|Q3LVA7|Q3LVA7_9ODON Cytochrome c oxidase subunit 2 OS=Brachythemis contaminata GN=COII PE=3 SV=1
MATWAQLNFQDATSPMMEQLHYFHDHTMMVLIIITIMVAYIMGAMFFNNNINRNLLDGQNIETTWTVLPVFVLIIIAMPSLRLLYLLDEVSEPSITLKTVGHQWYWSYEYSDFKHIEFDSYMIPYNEMDPNGFRLLEVDNRTTLPMETQVRMLITAADVLHSWTVPTLGVKVDATPGRLNQTSFFISRPGLFFGQCSEICGTNHSFMPIMIESVNIKSFIQWIQNMSEA