Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Orthetrum sabina (Drury, 1770) — Green Marsh Hawk
Male
Male
Male
Male
Others
Others
Others
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Orthetrum
- Species:
- Orthetrum sabina (Drury, 1770)
- Common name:
- Green Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Afghanistan, Algeria, Armenia, Australia, Azerbaijan, Bahrain, Bangladesh, Bhutan, Brunei Darussalam, Cambodia, Chad, China, Cyprus, Egypt, Eritrea, Ethiopia, Georgia, Greece, Hong Kong, India, Indonesia, Iran, Iraq, Israel, Japan, Jordan, Kazakhstan, Kuwait, Laos, Lebanon, Libya, Malaysia, Micronesia, Myanmar, Nepal, New Caledonia, Oman, Pakistan, Papua New Guinea, Philippines, Qatar, Russia, Samoa, Saudi Arabia, Singapore, Solomon Islands, Somalia, Sri Lanka, Sudan, Syrian Arab Republic, Tajikistan, Thailand, Timor-Leste, Tunisia, Turkey, Turkmenistan, United Arab Emirates, Uzbekistan, Vietnam, Yemen
- Identification Key:
- Abdomen enormously swollen at base and then abruptly slimmed and compressed laterally to the end; black marked with greenish-yellow, not pruinosed.
- Distinguishing Feature:
- Apart from more or less extensive black markings, this species shows but little variation (Samoa specimens are exactly similar to Malabar forms).
- Abdomen Size:
- Male: 33 mm
Female: 33.5 mm - Wing Size:
- Male: 33 mm
Female: 33 mm - Wing Spot:
- Male: Black with reddish brown
Female: Black with reddish brown - Eye Color:
- Male: Green mottled with black
Female: Green mottled with black
- Description:
- Orthetrum sabina is the most abundant and most common dragonfly of Bangladesh. Found in diverse habitat, all over the country and all year round. The spectacular dragonflies are green, white and black in color. The eyes are green, thorax are green and yellow, wings are transparent, pterostigma and legs are black, segments 7-10 are completely black, anal appendages are white. Orthretrum sabina are very aggressive. Sighted species are often seen to be feeding on butterflies, dragonflies and damselflies.
- COI Gene:
>gi|391352667|dbj|AB709092.1| Orthetrum sabina mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1111
ACTTGTACCATTAATACTAGGGGCACCAGATATAGCATTCCCACGACTTAATAACATAAGTTTTTGACTTTTACCTCCTTCATTCACCCTTTTATTAGCAAGTAGAATGGTTGAAAGTGGAGCAGGTACTGGATGAACTGTATACCCTCCTCTTGCAGGGGCAATTGCCCACGCAGGAGCATCAGTAGATTTAACAATTTTCTCACTACATTTAGCAGGAGTATCTTCTATTTTAGGAGCAATTAATTTTATCACTACGGTAATTAATATAAAGTCACCTGGAATAAAGCTGGATCAAATACCTTTATTTGTATGAGCAGTAGTAATTACTGCAGTTTTATTACTATTATCCTTACCAGTTTTAGCAGGTGCTATTACTATACTATTAACAGACCGTAATATTAATACATCATTTTTTGATCCTGCGGGAGGAGGAGATCCTATCTTATAT
- CO1 Protein:
>tr|I4DWS4|I4DWS4_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum sabina GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY