Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Palpopleura sexmaculata (Fabricius, 1787) — Asian Widow, Blue-Tailed Yellow Skimmer
Female
Female
Female
Female
Male
Male
Male
Male
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Palpopleura
- Species:
- Palpopleura sexmaculata (Fabricius, 1787)
- Common name:
- Asian Widow, Blue-Tailed Yellow Skimmer
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- Sylhet, Chittagong
- Global Distribution:
- Afghanistan, Bangladesh, China, Hong Kong, India, Laos, Myanmar, Nepal, Pakistan, Sri Lanka, Thailand, Vietnam
- Distinguishing Feature:
- smaller size and yellow, bluish body colour distinguish this species from other Bangladeshi species
- Abdomen Size:
- Male: 15 mm
Female: 13.5 mm - Wing Size:
- Male: 18 mm
Female: 19.5 mm - Wing Spot:
- Male: Black and white
Female: Black and white - Eye Color:
- Male: Bluish grey with brown cap
Female: Olive brown
- Description:
- Palpopleura sexmaculata is most likely the smallest dragonfly of Bangladesh. They are common in Chittagong and Sylhet.
- Male Description:
- The juvenile males can be differentiated from the broad greenish thorasic stripe, which are yellow in the adult. The juvenile males are similar to female, are yellow in color, has white pterostigma. However they can be distinguished by their anal appendages. The adult male have broad yellow thorasic, the abominal segments are white dorsally which is very prominent and can be used to differentiate from female. The wings are transparent, black stripes present in the wing bases, pterostigma and anal appendages are black.
- Female Description:
- The females are yellow in color and very similar to juvenile male and are often found associated with the male.
- COI Gene:
>gi|816457131|gb|KP241936.1| Palpopleura sexmaculata voucher MZDF24 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial
ATTGAATTAGGTCAGCCGGGGTCACTAATTGGGGATGACCAAATTTATAATGTAATTGTTACTGCTCATGCATTTGTTATAATTTTTTTTATAGTAATACCTATTATAATTGGAGGATTTGGTAACTGATTAGTACCTTTAATATTAGGAGCACCTGATATAGCTTTCCCACGACTTAATAACATAAGCTTTTGACTTTTACCCCCATCTTTTACTTTACTTCTAGCTAGAAGTATAGTTGAAAGAGGGGCAGGAACTGGGTGAACAGTATATCCTCCTCTGGCAGGAGGGATTGCTCATGCTGGGGCTTCAGTAGATTTAACTATTTTTTCTTTACATTTAGCAGGTGTTTCTTCAATTCTTGGTGCCATTAACTTTATTACCACTGTAATTAATATAAAGTCACCAGGAATAAAGCTAGATCAATTGCCATTATTTGTATGAGCAGTAGTAATTACTGCAGTATTATTACTTTTATCTCTTCCTGTTCTGGCAGGTGCCATTACTATACTTTTAACTGATCGTAACATTAATACATCGTTCTTTGACCCTGCAGGAGGGGGGGATCCCATTTTATATCAACACTTATTCTGATTTTTTGGGCACCCTGAAGTT
- CO1 Protein:
>tr|A0A0F6SCY9|A0A0F6SCY9_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Palpopleura sexmaculata GN=COI PE=3 SV=1
IELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGGIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFGHPEV