Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Crocothemis servilia (Drury, 1773) — Ruddy Marsh Skimmer
Male
Male
Male
Male
Male
Male
Male
Female
Female
Female
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Crocothemis
- Species:
- Crocothemis servilia (Drury, 1773)
- Common name:
- Ruddy Marsh Skimmer
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Afghanistan, Armenia, Cambodia, China, Hong Kong, India, Indonesia, Iran, Iraq, Israel, Japan, Jordan, Korea, Kuwait, Malaysia, Myanmar, Nepal, Pakistan, Philippines, Qatar, Saudi Arabia, Singapore, Sri Lanka, Syrian Arab Republic, Thailand, Turkey, Vietnam
- Distinguishing Feature:
- In these specimens there is a well-defined pale yellowish-white humeral stripe on each side of thorax, and a subdorsal stripe of the same colour runs the length of abdomen, the basal marking of wing is paler, the reticulation bright yellowish, and the pterostigma very pale yellow between black nervures.
- Abdomen Size:
- Male: 24.5 mm
Female: 28.5 mm - Wing Size:
- Male: 32.5 mm
Female: 34 mm - Wing Spot:
- Male: Dark brown white
Female: Dark brown white - Eye Color:
- Male: Brown above olivaceous below
Female: Paler
- Description:
- Ruddy Marsh Skimmer is one the most common and beautiful dragonflies of Bangladesh. They can be found all over the country, almost all year round. The males are red in color, legs are red, wings are transparent, amber tinted in the hind wing base. Black continuous stripe travel from abdominal segments 1-10, anal appendages are red too.
- Male Description:
- The males are often confused with Greater crimson glider (Urothemis signata) male, of which the species can be distinguish by comparing the dorsal black abdominal stripe, which is constricted to the last three segments of the abdomen. The immature male is orange in color. The juvenile male is yellow in color and very similar to female. Thats why distinguishing male - female based on color only is a wrong strategy. Anal appendages can be helpful to easily identify the male. Crocothemis servilia changes its color from yellow to orange to red as they progress to their adulthood.
- Female Description:
- Females are like juvenile males and are often confusing. However, they can be identified by comparing the terminal segments and anal appendages. The females are greyish in color with prominent black stripe in the dorsal region of the abdomen. Yellow amber in the hind wing is noticeable and the legs are also yellowish. Opaque lateral stripe present in the abdominal segments.
- COI Gene:
>gi|391352395|dbj|AB708956.1| Crocothemis servilia mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1123
ACTAGTGCCATTAATATTAGGAGCACCTGATATAGCATTCCCACGATTAAATAATATAAGATTTTGACTATTACCTCCCTCATTTACTTTACTATTAGCAAGAAGAATGGTAGAAAGAGGGGCAGGAACTGGATGAACAGTTTATCCACCGTTGGCTGGTGCAATTGCCCATGCTGGTGCATCTGTAGACTTAACCATCTTTTCCCTACACCTAGCAGGAGTATCATCAATTTTAGGAGCAATTAATTTTATCACTACAGTAATTAATATAAAGTCACCTGGTATAAAGTTGGATCAATTACCTTTATTTGTATGAGCAGTAGTAATTACTGCGGTATTACTTTTACTATCTTTACCAGTATTAGCAGGGGCTATTACTATGCTTTTAACAGATCGTAATATTAATACATCATTTTTTGATCCGGCAGGGGGTGGAGACCCAATTTTATAT
- CO1 Protein:
>tr|A0A059SQL8|A0A059SQL8_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Crocothemis servilia GN=COI PE=3 SV=1
IYNVIVTAHAFVMMFFMVMPIMMGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIIAQESGKKETFGVLGMIYAMVAIGILGFVVWAHHMFTVGMDVDTRAYFTSATMVIAVPTGIKIFSWLATLHGTQFSYSPPLLWALGFVFLFTIGGLTGIVLANSSIDIALHDTYYVVAHFHYVLSMGAVFAIMAGLVQWFSLFTGVTLNNHLLKAQFVVMFIGVNLTFFPQHFLGLS