Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Rhyothemis variegata (Linnaeus, 1763) — Common Picture Wing
Female
Female
Male
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Rhyothemis
- Species:
- Rhyothemis variegata (Linnaeus, 1763)
- Common name:
- Common Picture Wing
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, Cambodia, China, Hong Kong, India, Laos, Myanmar, Nepal, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Wings widely different in the sexes; male with whole of wings tinted yellow, fore- wing with spots at node, discoidal cell, apex, and at middle of Riii; hind-wing with similar dark spots and two broad longitudinal basal bands. Female with broader, shorter wing; fore-wing hyaline from node to apex, basal half with broad black markings, hind-wing with broad irregular markings to as far distal as pterostigma, apex hyaline.
- Distinguishing Feature:
- This species is easily distinguished from all other Bangladeshi species by the marking on thie wings
- Abdomen Size:
- Male: 24 mm
Female: 21 mm - Wing Size:
- Male: 34.5 mm
Female: 32.5 mm - Wing Spot:
- Male: Black
Female: Black - Eye Color:
- Male: Black reddish brown
Female: Black reddish brown
- Description:
- Rhyothemis variegata is one of the common and most abundant dragonflies of Bangladesh. The species is found all over the country and almost all year round. Rhyothemis variegata is the only Rhyothemis species found in Bangladesh. The species can be distinguished easily from the other species by its coloration pattern of the wings.
- Male Description:
- The male has golden wings with black colored patches in the fore and hind wing, wing tips are black, abdomen , thorax and legs are black.
- Female Description:
- The females are similar to males, however the coloration in the wing excels the coloration of the wing of male. Wing tips are transperant and anal appendages are typical Libellulidae female like; these two criteria distinguish the female from the male.
- COI Gene:
>gi|391352709|dbj|AB709113.1| Rhyothemis variegata mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1295
GCTTGTGCCATTAATATTAGGAGCACCAGATATGGCTTTCCCACGACTAAATAATATAAGATTTTGATTATTACCTCCCTCATTCACTTTATTACTTGCAAGAAGAGTAGTAGAAAGAGGGGCAGGAACAGGATGAACTGTATATCCACCATTAGCAGGAGCTATTGCTCATGCTGGAGCATCCGTAGATTTAACTATTTTTTCTTTACACTTAGCTGGAGTATCATCAATTTTAGGGGCAATTAATTTTATTACTACAGTAATTAATATAAAGTCACCAGGAATAAAAATAGATCAAATACCTTTATTTGTATGAGCTGTAGTAATTACTGCAGTGTTATTATTATTATCTCTACCTGTTCTTGCTGGAGCCATTACTATACTTTTAACTGATCGAAATATTAATACATCCTTCTTTGACCCAGCAGGAGGAGGAGATCCAATTCTTTAT
- CO1 Protein:
>tr|L7YCF0|L7YCF0_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Rhyothemis variegata GN=COI PE=3 SV=1
MIGTALSVLIRIELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSVVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFF