Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Agriocnemis femina (Brauer, 1868) — Pruinosed Dartlet
Male
Male
Female
Female
Female
Female
.jpg){kind=link}
Others
.jpg){kind=link}
Others
Others
Others
Others
Others
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Agriocnemis
- Species:
- Agriocnemis femina (Brauer, 1868)
- Common name:
- Pruinosed Dartlet
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Australia, Bangladesh, Brunei Darussalam, China, Guam, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Micronesia, Myanmar, Northern Mariana Islands, Palau, Philippines, Singapore, Solomon Islands, Sri Lanka, Thailand, Timor-Leste, Vietnam
- Identification Key:
- Labrum metallic blue. Superior anal appendages shorter than inferiors.
- Distinguishing Feature:
- Distinguished from all other species by the remarkable shape of its anal appendages.
- Abdomen Size:
- Male: 16.5 mm
Female: 18 mm - Wing Size:
- Male: 10.5 mm
Female: 11 mm - Wing Spot:
- Male: Yellow
Female: Pale brown - Eye Color:
- Male: Dark brown cap with apple green on sides
Female: Paler
- Description:
- Agriocnemis are the smallest damselflies of Bangladesh. A. femina shows different color variation in different developmental stages, which is why they are often called variable wisp. Due to their small size and difficulties to differentiate from A. pygmaea, they are often overlooked.
- Male Description:
- This male damselfly is a tiny one. The short abdomen is measured around 16-17 mm. Eyes of the damselflies are green with black capped above, blue or green post ocular spot present. Legs are pale yellow, the external side of the femora is black. The dorsum of the thorax black with green or blue antehumeral stripe, that extends to the prothorax. Hind wing length 10-11 mm, wings are clear, pterostigma black. Abdominal segments are dorsally black , laterally blue or green. Anal appendages are orange. The damselflies has two morphs mainly - the blue morph and green morph. In blue morph, the antehumeral stripes, post ocular spots and lateral portion of the abdominal segments are blue. Abdominal segment 8-10 are completely orange. The antehumeral stripes, post ocular spots and lateral portion of the segments are green, in green morph. Segment 8 is black dorsally, yellow ventrally, segement 9 and 10 are yellow as well as anal appendages. The pruinosed male of the species can be identified easily. As the male gets older, their thorax gets pruinosed.
- Female Description:
- The females of the species are difficult to identify. The female has two forms - red form and green form. The eyes are green, black cap above, no post ocular spot. Anterior lobe of the prothorax has a black spot, posterior lobe is large and elevated. Legs are whitish with black spine. Broad black stripe in the thorax, no clear antehumeral stripe. The wings are clear, yellow pterostigma. Abdominal segement 1-6 are red, broad black dorsal stripe present in segments 7-10. The antehumeral stripes are brick red, lateral portion of the thorax is turning into blue. Abdominal segments are yellow laterally. The andromorph female is similar to male, the antehumeral black stripe absent and the terminal anal appendages are different. A few mating pair of A. femina were documented. Presented one is from Sylhet, 12th October 2014, afternoon. The male was not pruinosed and the female was the green morph. It is very difficult to differentiate A. femina from A. pygmaea because they are very similar. Moreover, most often both species share the same microhabitat which makes it even more difficult. The best and simplest way to differentiate is by examining the anal appendages of the male specimen which are quiet different. The females are even more difficult to identify, however by close examining of the prothorax they can be differentiated. Finding a niche that contains either one of the species is an excellent way to study them.
- COI Gene:
>gi|391351405|dbj|AB708461.1| Agriocnemis femina mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1043
ACTGGTTCCTTTAATGTTAGGTGCACCAGATATAGCCTTCCCACGGCTTAATAACATGAGATTTTGATTATTACCCCCTTCACTAACATTATTACTGGCAAGTAGTTTAGTAGAAAGAGGAGCGGGTACCGGATGAACGGTCTATCCTCCTTTAGCGGGAGCTATTGCTCATGCAGGGGGATCAGTAGATCTTACTATTTTTTCACTTCATTTGGCTGGAGTTTCATCAATTTTAGGTGCAATCAATTTTATTACTACAACTATTAATATAAAATCACCCGGAATAAAAATAGAACAGTTACCTCTATTTGTATGAGCAGTAGTAATTACTGCTGTATTATTATTGTTATCTTTACCTGTATTAGCAGGTGCAATTACTATACTATTAACAGATCGTAATATCAATACATCATTTTTTGATCCGGCAGGGGGAGGAGACCCAATTTTATAT
- CO1 Protein:
>tr|U5T996|U5T996_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Agriocnemis femina GN=COI PE=3 SV=1
TLYLMFGAWAGMVGTALSMLIRVELGQPGSLIGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMKMEQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF