Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Orthetrum glaucum (Brauer, 1865) — Blue Marsh Hawk
Others
Others
Others
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Orthetrum
- Species:
- Orthetrum glaucum (Brauer, 1865)
- Common name:
- Blue Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Brunei Darussalam, China, Hong Kong, India, Indonesia, Japan, Malaysia, Myanmar, Nepal, Pakistan, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Moderately large species with face black or frons blackish anteriorly; membrane black.
- Distinguishing Feature:
- The species is somewhat like a large specimen of O. chrysostigma luzonicum, but has a small dark amber spot at base of wing and the face is wholly black in the adult. It differs from O. trianguiare by the longer and much narrower abdomen, blue with a black tip, and by the dull-coloured thorax and absence of black triangular black mark at base of hind-wing.
- Abdomen Size:
- Male: 32 mm
Female: 30 mm - Wing Size:
- Male: 36.5 mm
Female: 34.5 mm - Wing Spot:
- Male: Dark reddish brown
Female: Light brown - Eye Color:
- Male: Dark green capped with reddish brown
Female: Paler
- COI Gene:
>gi|391352519|dbj|AB709018.1| Orthetrum glaucum mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF798
ACTTGTCCCTTTAATATTAGGAGCACCTGATATAGCATTCCCACGACTTAATAATATAAGATTTTGATTATTACCTCCTTCATTTACTCTTTTACTAGCTAGAAGAATAGTTGAAAGTGGAGCAGGAACTGGATGAACCGTTTATCCTCCTCTTGCAGGAGCAATTGCTCATGCGGGTGCATCTGTAGATTTAACAATTTTTTCATTACATCTTGCAGGAGTATCTTCTATTTTAGGAGCAATTAATTTTATTACAACAGTAATTAATATAAAATCACCAGGAATAAAATTAGATCAAATACCTTTATTTGTATGAGCAGTAGTAATTACTGCAGTACTTTTACTATTATCCTTACCAGTTCTTGCAGGAGCAATCACTATACTTTTAACAGACCGAAATATTAATACTTCCTTTTTTGACCCTGCAGGAGGGGGAGATCCTATTCTATAC
- CO1 Protein:
>tr|I4DWJ9|I4DWJ9_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum glaucum GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY