Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Orthetrum pruinosum (Rambur, 1842) — Crimson-Tailed Marsh Hawk
Male
.jpg){kind=link}
Male
Others
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Orthetrum
- Species:
- Orthetrum pruinosum (Rambur, 1842)
- Common name:
- Crimson-Tailed Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- Dhaka, Sylhet, Chittagong, Khulna
- Global Distribution:
- Afghanistan, Bangladesh, Brunei Darussalam, China, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Myanmar, Nepal, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Males violaceous-red, due to a thin overlying pruinescence; frons blue-black anteriorly.
- Distinguishing Feature:
- There is no difficulty in distinguishing the adult male by its unique violet-colored abdomen, quite different to the red of chrysis and testaceum.
- Abdomen Size:
- Male: 29.5 mm
Female: 30 mm - Wing Size:
- Male: 34 mm
Female: 37 mm - Wing Spot:
- Male: Reddish brown
Female: Reddish brown - Eye Color:
- Male: Black and bluish grey
Female: Greyish brown
- Description:
- The males are spectacular insects with red abdominal segments. The thorax is black, legs are black, wings are transparent, pterostigma black. The spotted pair from Sylhet, was mating in the reeds associated to the streams.
- COI Gene:
>gi|391352663|dbj|AB709090.1| Orthetrum pruinosum mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1113
ACTTGTACCTTTAATATTAGGTGCACCAGATATAGCATTCCCTCGACTTAATAATATAAGATTTTGACTTTTACCTCCTTCATTCACCTTATTACTAGCAAGTAGTATAGTTGAAAGCGGTGCAGGAACAGGATGAACAGTTTATCCTCCCCTTGCAGGAGCAATTGCTCATGCTGGAGCATCTGTAGACTTAACAATTTTTTCTTTACACCTTGCTGGTGTATCTTCCATTTTAGGAGCTATTAATTTTATTACAACAGTAATTAATATAAAATCACCAGGTATAAAGCTAGATCAAATACCTTTATTTGTATGAGCAGTAGTAATTACAGCTGTATTACTACTTTTATCCTTACCCGTACTTGCAGGAGCAATTACTATACTCTTAACAGATCGAAATATTAATACTTCTTTCTTTGATCCTGCAGGAGGAGGAGATCCTATTTTATAT
- CO1 Protein:
>tr|I4DWS1|I4DWS1_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum pruinosum GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY