Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Ceriagrion coromandelianum (Fabricius, 1798) — Coromandel Marsh Dart, Yellow Waxtail
Others
Others
.jpg){kind=link}
Others
Male
Male
.jpg){kind=link}
Male
Male
Female
.jpg){kind=link}
Female
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Ceriagrion
- Species:
- Ceriagrion coromandelianum (Fabricius, 1798)
- Common name:
- Coromandel Marsh Dart, Yellow Waxtail
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- India, Nepal, Pakistan, Sri Lanka
- Identification Key:
- Abdomen bright citron-yellow, without markings.
- Distinguishing Feature:
- Easily distinguished from all others by its abdomen being entirely pale lemon-yellow, without markings.
- Abdomen Size:
- Male: 29 mm
Female: 30.5 mm - Wing Size:
- Male: 19 mm
Female: 20 mm - Wing Spot:
- Male: Golden yellow
Female: Pale yellow - Eye Color:
- Male: Olivaceous above & pale green below
Female: Pale greenish
- Description:
- Ceriagrion coromandelianum is the most common and abundant damselfly of Bangladesh.
- Male Description:
- The males are yellow, eyes and thorax are green. Observed commonly near the pond and can be identified easily by their yellow color.
- Female Description:
- The females are less yellow in color than the males, thorax and eyes are green. Anal appendages are female like and easier to distinguish. This species is very aggressive, often seen feeding on smaller damselflies.
- COI Gene:
>gi|913752695|gb|KT222949.1| Ceriagrion coromandelianum voucher CUCC 01-A1 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial
TAGTATATTAATTCGAGTTGAATTAGGTCAACCAGGATCCCTCATTGGAGATGACCAAATTTATAATGTAGTAGTAACAGCACATGCATTTGTAATAATTTTTTTCATAGTTATACCAATTATAATTGGAGGATTCGGAAATTGATTAGTTCCCTTGATATTAGGGGCACCTGATATAGCTTTCCCACGATTAAATAATATGAGATTTTGACTTTTACCTCCTTCATTAACACTACTATTAGCAAGAAGTTTAGTAGAAAGAGGAGCAGGTACTGGTTGAACAGTATATCCACCCCTTGCAGGAGCAATCGCACATGCAGGAGGATCTGTTGATTTAACAATTTTCTCATTACACTTAGCTGGAGTATCATCCATTTTAGGTGCAATTAATTTTATTACCACTGTAATTAATATAAAATCCCCAGGAATAAAATTAGACCAATTACCACTATTTGTATGGGCAGTAGTAATTACTGCAGTTTTATTGTTACTATCATTACCAGTATTAGCTGGTGCTATTACCATATTATTAACTGATCGAAACATCAATACATCATTCTTTGATCCAGCAGG
- CO1 Protein:
>tr|A0A0K1R058|A0A0K1R058_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Ceriagrion coromandelianum GN=COI PE=3 SV=1
SMLIRVELGQPGSLIGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAG