Orthetrum triangulare (Selys, 1878) — Blue-Tailed Forest Hawk
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Orthetrum
- Species:
- Orthetrum triangulare (Selys, 1878)
- Common name:
- Blue-Tailed Forest Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Rare
- Flight Seasons:
- April - June, October
- Local Distribution:
- Sylhet, Chittagong
- Global Distribution:
- Afghanistan, Bhutan, China, Hong Kong, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Pakistan, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Base of hind-wing with a large black triangular marking.
- Distinguishing Feature:
- This very robust insect is easily distinguished by its black color and by the black triangular mark at base of hind-wings.
- Abdomen Size:
- Male: 31 mm
Female: 30.5 mm
- Wing Size:
- Male: 39 mm
Female: 37 mm
- Wing Spot:
- Male: Black
Female: Brownish black
- Eye Color:
- Male: Dark blue
Female: Brown
- Description:
- Orthetrum triangulare is one of the six Orthetrum species found in Bangladesh.
- Male Description:
- The male is black and white species. The thorax is black, abdominal segments 1-7 are bluish, segments 8-10 are black.
- Female Description:
- The female are yellow in color, broad black antehumeral stripe present and abdominal 8-10 are black which is the signature of this species. Sighted on the forest patches of the north eastern forests of Bangladesh.
- COI Gene:
>gi|391352671|dbj|AB709094.1| Orthetrum triangulare mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF784
ACTTGTACCTTTAATATTAGGAGCGCCAGATATAGCTTTCCCCCGACTTAATAATATAAGATTTTGACTTCTTCCTCCTTCATTTACTTTATTACTATCAAGTAGTATAGTTGAAAGAGGTGCAGGAACAGGATGAACAGTTTATCCTCCACTTGCAGGAGCTATTGCTCACGCTGGAGCATCCGTAGATTTAACAATCTTCTCATTACATCTTGCAGGAGTATCTTCTATTCTAGGAGCTATCAATTTTATTACTACAGTAATTAATATAAAATCACCAGGTATAAAATTAGATCAACTACCTCTATTTGTATGAGCAGTAGTAATTACAGCAGTATTATTACTTTTATCATTACCAGTACTTGCAGGAGCAATTACTATACTTTTAACAGACCGAAATATTAATACTTCTTTCTTTGATCCCGCAGGAGGAGGAGATCCTATTTTATAT
- CO1 Protein:
>tr|I4DWS9|I4DWS9_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum triangulare GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLSSSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY