Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Epophthalmia vittata (Burmeister, 1839) — Common Torrent Hawk
- Suborder:
- Anisoptera
- Family:
- Macromiidae
- Genus:
- Epophthalmia
- Species:
- Epophthalmia vittata (Burmeister, 1839)
- Common name:
- Common Torrent Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Rare
- Flight Seasons:
- May - July
- Local Distribution:
- Dhaka, Sylhet, Khulna
- Global Distribution:
- India, Indonesia, Sri Lanka, Vietnam
- Identification Key:
- Bases of wings of female only, and only occasionally, with dark brown costal rays; superior anal appendages poorly angulated on the outer side near the middle. Superior surface of frons with a single medial yellow spot in the floor of the notch.
- Distinguishing Feature:
- The general dark ochreous color (generally a light brownish-yellow color) of the dragonfly, together with its broad yellow annules on the abdomen distinguish this species from rest of the Bangladeshi odonata.
- Abdomen Size:
- Male: 53.5 mm
Female: 58 mm - Wing Size:
- Male: 50 mm
Female: 50.5 mm - Wing Spot:
- Male: Blackish brown
Female: Unknown - Eye Color:
- Male: Bluish green
Female: Unknown
- Female Description:
- Females differ from the males in sexual characteristics and wing pigmentation. Female wings are tinted with amber in the costal, subcostal and cubital spaces.
- COI Gene:
>KC915255.1 Wolbachia endosymbiont of Epophthalmia vittata strain AR56 cytochrome c oxidase subunit I (coxA) gene, partial cds
ATGCGTGCAAAGGGCATGTCATTAACTAAGATGCCACTATTTGTTTGGTCTGTTTTATTAACGTCATTCATGTTAATTGTCGCTTTACCGGTGCTCGCTGGTGCTATAACTATGCTGCTTACTGATCGCAATATTGGTACTTCCTTTTTTGATCCTGCCGGAGGTGGTGACCCTGTATTGTTTCAACATCTATTTTGGTTTTTTGGTCATCCGGAAGTTTACGTAATTATTTTTCCTGCGTTTGGTATCATAAGCCAAATCGTATCAACTTTTTCTCATAGGCCGATATTTGGTTATATGGGAATGGTTTACGCAATGATAGGCATAGCAGTATTTGGCTTTATGGTTTGGGCTCATCATATGTTTACTGTTGGGCTTAGTGAAGATGCTGCCATATTTTTT
- CO1 Protein:
>AHN62625.1 cytochrome c oxidase subunit I, partial [Wolbachia endosymbiont of Epophthalmia vittata]
MRAKGMSLTKMPLFVWSVLLTSFMLIVALPVLAGAITMLLTDRNIGTSFFDPAGGGDPVLFQHLFWFFGHPEVYVIIFPAFGIISQIVSTFSHRPIFGYMGMVYAMIGIAVFGFMVWAHHMFTVGLSEDAAIFF