Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Diplacodes trivialis (Rambur, 1842) — Ground Skimmer
Male
Male
Male
Female
.jpg){kind=link}
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Diplacodes
- Species:
- Diplacodes trivialis (Rambur, 1842)
- Common name:
- Ground Skimmer
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Australia, Bangladesh, Brunei Darussalam, Cambodia, China, Fiji, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Micronesia, Myanmar, Nepal, Papua New Guinea, Philippines, Seychelles, Singapore, Solomon Islands, Sri Lanka, Thailand, Timor-Leste, Vietnam
- Identification Key:
- Apices of wings hyaline. Adults black marked with yellow or pruinosed dark blue throughout; wings uncoloured except at base; anal appendages yellow.
- Distinguishing Feature:
- The clear wings, without apical or basal markings, and the creamywhite anal appendages and deep pruinescence in adult age, will serve to determine this species from others of the genus.
- Abdomen Size:
- Male: 20.5 mm
Female: 19 mm - Wing Size:
- Male: 22.5 mm
Female: 23 mm - Wing Spot:
- Male: Dark grey or black
Female: Dark grey or black - Eye Color:
- Male: Reddish brown & pale bluish
Female: Paler
- Description:
- Diplacodes trivialis is one of the most common dragonflies of Bangladesh. Unlike many other species they spend most of their time outside of the water bodies. They like to rest and fly near the ground.
- Male Description:
- The males are bluish black. The thorax is blue as well as the abdominal segments 1-8. Segments 9-10 are black, wings transparent, legs black and anal appendages are white.
- Female Description:
- The females have greenish thorax and abdomnal segments 1-3. Abdominal segments 4-8 have white lateral band, segments 9-10 are black, wings transparent, legs and anal appendages are black.
- COI Gene:
>gi|391352417|dbj|AB708967.1| Diplacodes trivialis mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1202
GTTAGTTCCTTTAATATTAGGAGCACCAGATATGGCCTTTCCACGACTAAATAATATAAGATTTTGATTATTACCTCCATCATTTACACTACTTTTAGCAAGAAGAATAGTAGAAAGAGGGGCAGGAACAGGATGAACAGTTTATCCACCCTTAGCTGGGGCTATTGCCCATGCAGGGGCCTCTGTTGATCTAACAATTTTTTCATTACATCTTGCAGGGGTTTCATCTATTCTTGGTGCAATCAATTTTATTACCACAGTAATTAATATAAAATCTCCAGGTATAACACTAGATCAGTTACCACTATTTGTATGAGCAGTAGTAATTACAGCTGTTTTACTTTTATTATCTTTACCCGTATTAGCAGGTGCTATTACAATACTACTAACTGATCGAAATATTAATACATCATTTTTTGACCCGGCAGGTGGTGGAGATCCAATTCTTTAT
- CO1 Protein:
>tr|L7YDG0|L7YDG0_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Diplacodes trivialis GN=COI PE=3 SV=1
MIGTALSVLIRIELGQPGSLIGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMTLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFG