Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Acisoma panorpoides (Rambur, 1842) — Trumpet Tail
Female
.jpg){kind=link}
Male
.jpg){kind=link}
Male
.jpg){kind=link}
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Acisoma
- Species:
- Acisoma panorpoides (Rambur, 1842)
- Common name:
- Trumpet Tail
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- February - November
- Local Distribution:
- Rajshahi, Rangpur, Dhaka, Sylhet, Chittagong, Khulna
- Global Distribution:
- Algeria, Angola, Benin, Botswana, Burkina Faso, Chad, China, Egypt, Equatorial Guinea, Ethiopia, Gambia, Ghana, Guinea, Hong Kong, India, Indonesia, Ivory Coast, Japan, Kenya, Liberia, Libya, Madagascar, Malawi, Malaysia, Mozambique, Myanmar, Namibia, Nepal, Nigeria, Pakistan, Philippines, Senegal, Sierra Leone, Singapore, South Africa, Sri Lanka, Swaziland, Tanzania, Thailand, Togo, Uganda, Vietnam, Zambia, Zimbabwe
- Distinguishing Feature:
- The species has a very weak and short flight and keeps closely to rank herbage and reeds in the heavily weeded tanks and lakes in which it breeds. The characteristic shape of the abdomen will serve to distinguish this species from other Indian Libellulines.
- Abdomen Size:
- Male: 16.5 mm
Female: 16.5 mm - Wing Size:
- Male: 18.5 mm
Female: 19.5 mm - Wing Spot:
- Male: Pale yellow
Female: Pale yellow - Eye Color:
- Male: Blue
Female: Greenish
- Description:
- This little but enchanting dragonfly of Libellulidae family love to stay in close proximity of water bodies. They are often sighted perching on the reeds of ponds and lakes.
- Male Description:
- The males are small with abdomen length of 15-18 mm. The length of the hind wing are 16-21 mm. The face is of pale blue color, eyes are blue. Legs are black. Wings are transparent and hyaline with pale yellow pterostigma. Thorax is blue with numerous black spots dorsally and laterally. Abdomen is blue, segment 1-5 are widely dilated whereas 6-10 are precipitously slim and slender. Segment 1-7 are dorsally black and laterally blue. Segment 8-10 are black. Caudal appendages are white and longer than segment 10. The females are of similar size and shape than male.
- Female Description:
- The females are of yellowish color. The face is yellowish, eyes are green with brown cap. Legs are black, wings transparent with pale yellow wing spot. Abdominal segment 1-5 are dilated, dorsal black line from 1-7. White lateral line at segment 6 and 7, Segment 8-10 black. Anal Appendages are white and wider in comparison to male.
- COI Gene:
>gi|391352361|dbj|AB708939.1| Acisoma panorpoides mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1393
ACTTGTACCTCTAATACTAGGAGCTCCAGATATAGCGTTCCCACGATTAAATAATATAAGATTTTGATTATTACCTCCTTCTTTTACATTACTTTTATCTAGTAGTATAGTAGAAAGAGGAGCAGGAACAGGTTGAACTGTTTATCCACCATTAGCAGGTGCAATTGCTCATGCAGGTGCATCAGTAGATCTAACGATTTTCTCACTTCATTTAGCTGGGGTTTCCTCAATTCTAGGAGCCATTAATTTTATTACAACAGTAATTAATATAAAATCACCTGGAATAAAGCTAGATCAAATACCTCTTTTTGTATGAGCAGTAGTAATTACTGCTGTCCTTCTTTTATTATCTTTACCCGTATTGGCTGGAGCAATTACAATGTTATTGACTGATCGAAATATCAATACATCATTCTTCGATCCTGCCGGAGGGGGAGATCCTATTCTATAT
- CO1 Protein:
>tr|Q3LVA2|Q3LVA2_9ODON Cytochrome c oxidase subunit 2 OS=Acisoma panorpoides GN=COII PE=3 SV=1
MATWAQLNFQDAASPIMEQLHYFHDHTMMVLVIITVMVAYVMGVMFFNNNINRNLLDGQKIETAWTILPVFVLVIIAMPSLRLLYLLDEVSEPSITLKTVGHQWYWSYEYSDFKHVEFDSYMIPYNEMDNSGFRLLEVDNRTTLPMQTQVRILITAADVLHSWTVPSLGVKVDATPGRLNQTSFFINRPGLFFGQCSEICGANHSFMPIMIESINIKSFINWIQNMSEA