Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Trithemis festiva (Rambur, 1842) — Black Marsh Glider
Male
.jpg){kind=link}
Male
.jpg){kind=link}
Male
.jpg){kind=link}
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Trithemis
- Species:
- Trithemis festiva (Rambur, 1842)
- Common name:
- Black Marsh Glider
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- Sylhet, Chittagong, Khulna
- Global Distribution:
- Afghanistan, Cambodia, China, Cyprus, Greece, Hong Kong, India, Indonesia, Iran, Iraq, Laos, Malaysia, Myanmar, Nepal, Pakistan, Papua New Guinea, Philippines, Russia, Singapore, Sri Lanka, Thailand, Turkey, Vietnam
- Identification Key:
- Thorax and abdomen violaceous-black base of hindwing with a small dark brown spot; neuration black.
- Distinguishing Feature:
- The male has to be distinguished from Indothemis limbata and I. sita, the best guide to which is the character of the venation of wings.
- Abdomen Size:
- Male: 24.5 mm
Female: 22.5 mm - Wing Size:
- Male: 29 mm
Female: 29 mm - Wing Spot:
- Male: Black
Female: Black - Eye Color:
- Male: Dark brown above bluish grey on side
Female: Brown
- Description:
- Commonly, this species is observed nearby streams, waterfalls and stream associated forest patches. The species is distinguished from other species by its black color, bluish abdomen and yellow markings in the abdominal segments.
- Male Description:
- The male has blue thorax, legs are black, wings are transperant, and yellow patches present in the wing base. The observed male from Khagrachari near richag water falls was perching in the reeds of the streams. As the male gets older, it becomes more black. The thorax turns black from blue. Also, the abdominal yellow markings get abolished.
- COI Gene:
>gi|385654619|gb|JN817429.1| Trithemis festiva voucher MZDF06 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial
AGAGTTCTAATTCGAATTGAATTAGGACAACCAGGATCTCTTATTGGAGATGATCAAATTTATAATGTTATTGTTACAGCACATGCATTTGTAATAATTTTTTTTATAGTAATACCTATTATAATTGGTGGATTTGGTAATTGATTAGTACCTTTAATATTAGGAGCACCAGATATAGCATTTCCACGACTTAATAATATAAGATTCTGATTATTACCTCCTTCATTCACTCTATTATTAGCAAGAAGTATAGTAGAAAGAGGTGCAGGAACAGGATGAACCGTATATCCTCCTCTAGCTGGAGCAATTGCTCATGCTGGAGCATCTGTAGACTTAACAATTTTTTCTCTTCATCTTGCAGGAGTATCATCAATTTTAGGAGCGATTAATTTTATTACAACAGTAATTAATATGAAATCACCTGGAATAAATCTAGATCAAATACCATTGTTTGTATGAGCTGTAGTAATTACTGCAGTATTATTATTATTATCACTTCCAGTTTTAGCAGGAGCTATTACAATATTATTGACAGATCGTAATATTAATACATCATTTTTTGATCCTGCGGGAGGAGGAGATCCAATTTTATATCAGCACTTATTTTGATTTTTT
- CO1 Protein:
>tr|Q3LVB8|Q3LVB8_9ODON Cytochrome c oxidase subunit 2 OS=Trithemis festiva GN=COII PE=3 SV=1
MATWAQLNFQDASSPMMEQLHYFHDHTMMVLVIITIMVAHIMGMMFINKDINRNLLDGQKIETAWTILPVFVLVIIAMPSLRLLYLLDEVSEPSITLKTVGHQWYWSYEYSDFKHIEFDSYMIPYGEMENNGFRLLEVDNRTTLPMQTQVRVLVTAADVLHSWTVPSLGVKVDATPGRLNQTSFFINRPGVFFGQCSEICGSNHSFMPIMIESVNIKSFINWIQNMNEA