Odonata of Bangladesh

List of Species

Orthetrum luzonicum (Brauer, 1868) — Tricolored Marsh Hawk

Suborder:: Anisoptera
Family:: Libellulidae
Genus:: Orthetrum
Species:: Orthetrum luzonicum (Brauer, 1868)

Common name:: Tricolored Marsh Hawk
Global IUCN status:: Least Concern

Eco-system:: Terrestrial, Freshwater
Abundance:: Common
Flight Seasons:: June - April
Local Distribution:: Sylhet, Chittagong
Global Distribution:: Afghanistan, Bangladesh, Bhutan, China, Hong Kong, India, Indonesia, Japan, Malaysia, Myanmar, Nepal, Philippines, Singapore, Sri Lanka, Thailand, Vietnam

Distinguishing Feature:: Many variations are found, as in all pruinosed species, these differing according to the age of individuals and amount of pruinescence obscuring the teneral markings.
Abdomen Size:: Male: 29 mm
Female: 30 mm
Wing Size:: Male: 31 mm
Female: 31 mm
Wing Spot:: Male: Yellowish
Female: Yellowish
Eye Color:: Male: Bluish green with brownish spots
Female: Brownish

COI Gene:

>gi|391352545|dbj|AB709031.1| Orthetrum luzonicum mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1115

ACTTGTACCATTAATATTAGGAGCTCCTGATATAGCATTTCCTCGACTTAATAACATAAGATTTTGATTACTTCCTCCATCATTCACTTTATTATTAACTAGTAGAATAGTTGAAAGTGGGGCTGGAACAGGATGAACAGTATATCCTCCTCTTGCAGGAGCAATTGCACATGCGGGAGCATCTGTAGATTTAACAATTTTTTCCTTGCATCTTGCAGGAGTATCTTCTATTCTAGGAGCAATCAATTTTATTACAACAGTAATCAATATAAAATCACCAGGTATAAAGATAGACCAAATACCATTATTTGTATGGGCAGTAGTAATTACAGCCGTATTATTACTTTTATCTTTACCAGTTCTTGCAGGAGCAATTACCATACTATTAACAGACCGAAATATTAACACCTCTTTCTTTGATCCTGCAGGAGGAGGAGACCCCATTTTATAT

CO1 Protein:

>tr|I4DWL2|I4DWL2_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum luzonicum GN=COI PE=3 SV=1

LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLTSSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY

Copyright © 2020-2022, All Rights Reserved. Odonata of Bangladesh holds copyright for all the original material and compilations on this website, although contributing writers and photographers may hold copyright for their material. Material from this website can be used freely for educational, basic research and conservation purposes, provided that this website is acknowledged and properly cited as the source. Contact us to obtain prior permission for any other use.