Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Agriocnemis pygmaea (Rambur, 1842) — Pygmy Dartlet
Female
Female
Female
Male
Male
Others
Others
Others
Others
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Agriocnemis
- Species:
- Agriocnemis pygmaea (Rambur, 1842)
- Common name:
- Pygmy Dartlet
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round, High in June - August
- Local Distribution:
- All over the country
- Global Distribution:
- Afghanistan, Australia, Bangladesh, Bhutan, Brunei Darussalam, Cambodia, China, Hong Kong, India, Indonesia, Iran, Japan, Laos, Macao, Malaysia, Myanmar, Nepal, Oman, Pakistan, Papua New Guinea, Philippines, Seychelles, Singapore, Solomon Islands, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Labrum metallic blue. Superior anal appendages longer than inferiors.
- Distinguishing Feature:
- The male is easily distinguished by the pterostigma differing in color in the fore- and hind-wings, by the reddish colored end-segments of abdomen, and by the shape of the anal appendages. Teneral females are more difficult to distinguish from others, as the whole genus shares in the same colouring in the young or newly emerged form; the unenclosed antehumeral stripes will, however, help to distinguish the adult.
- Abdomen Size:
- Male: 16.5 mm
Female: 18 mm - Wing Size:
- Male: 9.75 mm
Female: 11.5 mm - Wing Spot:
- Male: Pale yellow in forewing & black in hindwing
Female: Yellowing fore and hindwing - Eye Color:
- Male: Pale blue capped with black
Female: Yellow with black cap
- Description:
- Agriocnemis pygmaea, a closely similar species of Agriocnemis femina, is a small damselfly often found in the grassland associated to water bodies. They are tiny, maintain small territory, stay close to ground and fly slowly within a short range. Due to their small size often they become prey of many other damselfles and dragonflies.
- Male Description:
- Male Agriocnemis pygmaea is morphologically similar to Agriocnemis femina. The length of the abdomen is 16-17 mm and the length of the hind wing is 9-10 mm. The eyes are green, black capped, post ocular spot present. Thorax is black dorsally marked with apple green antehumeral stripes and green laterally. Legs are whitish. Wings are transparent, Pterostigma pale yellow in the fore wing, black in the hind wing, 6-7 post nodal vein in the fore wing 5-6 in the hind wing. Black stripe travels from segment 1 to segment 7 dorsally, pale yellow laterally, segment 1 and ventrally green. Segment 8-10 and caudal appendages orange.
- Female Description:
- Females, Like many other female damselflies, Agriocnemis pygmaea shows different color morphs, mainly red morph and green morph. Eyes are pale green, brownish cap above. Broad black stripe in the thorax, associated with adjacent thin bluish stripe. Legs are whitish with black spines. Wings are transparent with golden pterostigma. Abdominal segments are red, with apical black ring in segment 2-6. Abdominal segments 7-10 are dorsally black, Caudal appendages are red. In green form, blue post ocular spot are visible. The antehumeral stripes are blue, thorax is laterally green. The abdominal segments are dorsally black and laterally green. Both the red and green morph have been observed mating. They usually perch from the grass while mating. Mating lasts for a few minutes. Distinguishing A. femina from A. pygmaea is quite difficult, however by close comparison of the anal appendages it can be done.
- COI Gene:
>gi|391351409|dbj|AB708463.1| Agriocnemis pygmaea mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1041
ATTAGTTCCATTAATATTAGGGGCGCCAGATATAGCCTTTCCACGAATTAATAATATAAGATTTTGATTGTTACCACCCTCACTAACATTATTATTAGCAAGAAGTTTAGTAGAAAGAGGGGCAGGTACTGGATGAACAGTCTATCCTCCCCTAGCAGGGGCTATTGCCCATGCGGGAGGATCTGTAGACCTCACTATTTTTTCACTCCATTTGGCAGGAGTTTCATCAATTTTAGGAGCAATTAACTTTATTACTACTACTATTAATATAAAATCACCTGGAATAAAAATGGAACAACTACCTTTATTTGTATGAGCAGTAGTAATTACTGCCGTATTACTATTACTATCCTTACCCGTACTAGCAGGAGCTATCACTATACTATTAACAGACCGTAATATTAATACATCATTCTTTGACCCAGCTGGAGGAGGGGATCCAATTCTATAT
- CO1 Protein:
>tr|I4DUZ5|I4DUZ5_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Agriocnemis pygmaea GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMKMEQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY