Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Brachydiplax sobrina (Rambur, 1842) — Little Blue Marsh Hawk
Male
Male
Male
Male
Female
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Brachydiplax
- Species:
- Brachydiplax sobrina (Rambur, 1842)
- Common name:
- Little Blue Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- February - March, May - December
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, India, Myanmar, Nepal, Sri Lanka, Thailand
- Identification Key:
- Dorsum of thorax thinly or not pruinosed; sides of thorax dark metallic or yellow marked with black; bases of wings tin-colored or but very palely so. Only 7 antenodal nervures in fore-wing; male sexual organs projecting markedly as seen in profile.
- Distinguishing Feature:
- This species is easily identified by its large genitalia
- Abdomen Size:
- Male: 22 mm
Female: 19 mm - Wing Size:
- Male: 26.5 mm
Female: 24 mm - Wing Spot:
- Male: Yellow with black border
Female: Yellow with black border - Eye Color:
- Male: Coffee brown & pale yellow
Female: Grey paling below
- Male Description:
- The juvenile male is yellow and black in color. The male is dorsally black with yellow lateral spots. As the male becomes mature, it starts to change its color, particularly the color of abdominal segments 3-6 which start to turn whitish. Segments 7-9 has lateral yellow spots anal appendages black. As male become more mature, the segments 3-6 turn into bluish and the 7-10 turn into black. The fully mature male is black and white in color. The thorax is pruinosed, abdominal segments 1-6 are white, 7-10 are black in color. Brachydiplax species is confusing as B. sobrina is often confused with B. farinosa. B. sobrina can be identified by counting the presence of 7 antenodal veins which is 8 or more in B. farinosa.
- COI Gene:
>gi|444300739|gb|KC287154.1| Brachydiplax sobrina voucher MZDF20 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial
ATAATTGGAACAGCTTTAAGAGTTTTAATTCGTATTGAATTAGGTCAGCCAGGATCTCTAATTGGTGATGATCAGATTTATAATGTTATTGTTACAGCTCACGCATTTGTCATAATCTTCTTTATAGTAATGCCAATCATAATTGGTGGTTTCGGAAACTGGCTAGTACCATTGATACTAGGGGCGCCAGATATAGCATTTCCACGTTTAAACAATATAAGATTTTGATTATTACCCCCATCCTTTACACTTCTTTTAGCAAGAAGAATGGTTGAAAGTGGAGCAGGAACTGGATGAACAGTTTACCCTCCACTAGCAGGAGCAATTGCTCATGCGGGAGCCTCAGTTGACTTAACTATTTTCTCCTTACACTTAGCAGGGGTATCATCAATTTTAGGTGCTATTAATTTTATTACAACAGTAATTAATATAAAGTCACCAGGAATAAAAATAGATCAAATACCTTTATTTGTATGAGCAGTAGTAATTACTGCAGTACTATTATTACTATCTTTACCAGTATTAGCTGGTGCTATTACAATACTATTAACTGACCGAAATATCAATACATCATTTTTTGATCCCGCAGGA
- CO1 Protein:
>tr|L7Y8A5|L7Y8A5_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Brachydiplax sobrina GN=COI PE=3 SV=1
MIGTALSVLIRIELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAG