Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Brachydiplax chalybea (Brauer, 1868) — Rufous-Backed Marsh Hawk
Female
/9.jpg){kind=link}
Male
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Brachydiplax
- Species:
- Brachydiplax chalybea (Brauer, 1868)
- Common name:
- Rufous-Backed Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- February - December
- Local Distribution:
- All over the country
- Global Distribution:
- Brunei Darussalam, Cambodia, China, Hong Kong, India, Indonesia, Japan, Laos, Malaysia, Myanmar, Philippines, Singapore, Thailand, Vietnam
- Identification Key:
- Dorsum of thorax densely pruinosed; sides of thorax and basal segments of abdomen ferruginous; bases of all wings burnt-brown or golden-brown.
- Distinguishing Feature:
- This species is easily distinguished by its larger size and by the characteristic colouring of the thorax and wing base
- Abdomen Size:
- Male: 23 mm
Female: 21 mm - Wing Size:
- Male: 28 mm
Female: 28 mm - Wing Spot:
- Male: Yellow with black border
Female: Yellow with black border - Eye Color:
- Male: Deep brown & pale yellow
Female: Deep brown & pale yellow
- Description:
- Till date, three Brachydiplax species have been recorded from Bangladesh. Among them, Brachydiplax chalybea can be distinguished easily by looking at the trademark color of its thorax.
- Male Description:
- The juvenile male is orange in color, the terminal abdominal appendages particularly 9-10 and the anal appendages is black. The sighted male species is a little more mature but not fully mature. The lateral part of the thorax is orange, dorsal part of the thorax is pruinosed lightly, wings transperant, abdomen orange except the terminal three which are black. The adult male can be distinguished from the other male by the orange thorax, The wings are transperant, upper part of femur is orange, rest of the leg is black, terminal abdominal segments are black.
- Female Description:
- The female are orange in color and are difficult to find. They stay outside of the water bodies in the forest patches. Terminal abdominal segments and anal appendages are black.
- COI Gene:
>gi|391352377|dbj|AB708947.1| Brachydiplax chalybea mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: RF1105
ACTTGTACCTTTAATACTAGGAGCCCCAGATATGGCATTCCCACGCCTAAATAATATAAGATTTTGACTTTTACCACCATCATTTACATTATTATTAGCAAGAAGAGTAGTTGAAAGAGGTGCAGGAACGGGATGAACCGTTTATCCCCCACTAGCAGGAGCAATTGCCCATGCAGGAGCCTCCGTTGATCTAACAATTTTCTCTCTCCATTTAGCAGGTGTATCATCAATTCTAGGTGCAATTAATTTTATTACAACAGTAATCAATATAAAGTCACCTGGGATGACAATAGATCAAATACCTTTATTTGTATGAGCAGTAGTAATTACTGCTGTACTCCTTCTATTATCACTTCCAGTTCTAGCAGGTGCTATTACAATATTACTAACAGATCGAAATATTAACACTTCATTCTTTGACCCCGCAGGAGGGGGAGACCCTATTTTATAC
- CO1 Protein:
>tr|L7YCF4|L7YCF4_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Brachydiplax chalybea GN=COI PE=3 SV=1
IRIELGQPDSLIGDVQVYNVIVTAHAFVMIFFMVLPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF