Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Ceriagrion cerinorubellum (Brauer, 1865) — The Orange-Tailed Marsh Dart, Bi-Colored Damsel
Female
Female
Others
Others
Others
Others
Male
Male
Male
Male
Male
Male
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Ceriagrion
- Species:
- Ceriagrion cerinorubellum (Brauer, 1865)
- Common name:
- The Orange-Tailed Marsh Dart, Bi-Colored Damsel
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- February - December
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, Brunei Darussalam, Cambodia, India, Indonesia, Laos, Malaysia, Myanmar, Pakistan, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Abdomen bright red at base and anal ends, black on dorsum in between.
- Distinguishing Feature:
- The beautiful combination of colors of the abdomen will surve to distinguish it from all other species of the genus.
- Abdomen Size:
- Male: 32 mm
Female: 33 mm - Wing Size:
- Male: 20.5 mm
Female: 20.5 mm - Wing Spot:
- Male: Amber colored
Female: Pale amber - Eye Color:
- Male: Olivaceous above & pale green below
Female: Bluish above & pale green below
- Description:
- Ceriagrion cerinorubellum is one of the most beautiful damselflies of Bangladesh. The colorful species is found all over the country and often found in the pond sides. The males are more colorful than female. Thorax is blue, abdominal segments 1-2.5 and 7.5-10 are orange.
- Male Description:
- The males are yellow, eyes are laterally green. Abdominal segments 3-6 are laterally black. The prothorax and thorax are dorsally greenish. The eyes are green, frons are gereenish yellow. The hock like anal appendages are black and white in color.
- Female Description:
- The females are similar to males. However, the orange color in the abdomen is lighter than the males. Abdominal segments 9-10 are orange, 3-8 are laterally bluish.
- COI Gene:
>gi|697993200|dbj|AB860310.1| Ceriagrion cerinorubellum mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: CCER1
ATTGGTTCCTTTAATATTAGGGGCACCTGATATAGCTTTTCCACGCTTAAATAATATGAGATTTTGACTACTACCTCCTTCACTAACTCTATTGTTAGCAAGAAGTTTAGTAGAAAGAGGTGCAGGTACCGGTTGAACGGTTTATCCTCCATTAGCAGGAGCTATTGCTCACGCAGGAGGTTCTGTTGACTTAACAATTTTTTCCTTACATTTAGCAGGTGTATCTTCAATTTTAGGAGCAATTAATTTTATCACTACAGTAATTAATATAAAATCACCAGGAATAAATTTGGATCAACTACCACTATTTGTATGGGCAGTAGTAATTACTGCAGTATTACTATTATTATCATTACCAGTATTAGCTGGTGCTATTACAATATTATTAACAGATCGAAATATTAATACATCATTTTTTGACCCAGCAGGGGGAGGAGATCCTATTTTATAT
- CO1 Protein:
>tr|A0A0A1G9Z7|A0A0A1G9Z7_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Ceriagrion cerinorubellum GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGAIAHAGGSVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMNLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY