Odonata of Bangladesh

List of Species

Gynacantha subinterrupta (Rambur, 1842) — Dingy Dusk Hawker

Immature

Suborder:: Anisoptera
Family:: Aeshnidae
Genus:: Gynacantha
Species:: Gynacantha subinterrupta (Rambur, 1842)

Common name:: Dingy Dusk Hawker
Global IUCN status:: Least Concern

Eco-system:: Terrestrial, Freshwater
Abundance:: Rare
Flight Seasons:: All year round, High in May - November
Local Distribution:: Rajshahi, Dhaka, Sylhet, Chittagong, Khulna
Global Distribution:: Cambodia, China, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Singapore, Thailand, Vietnam

Identification Key:: Wings tinted with amber-yellow at extreme bases.
Distinguishing Feature:: Easily determined from all other species by the shape of the superior anal appendages and by the discoidal cells made up of only 5 cells, which is very unusual in the genus.

COI Gene:

>MG884723.1 Gynacantha subinterrupta isolate OA-83 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial 

TCTTGCTGGTGCAATCGCACATGCTGGTGCATCAGTAGATTTAACTATTTTTTCATTACATCTTGCTGGAGTATCATCCATTTTGGGAGCCATTAATTTTATTACTACAACAATTAATATAAAGTCCCCAGGAATAAAGTTAGATCAAATACCTTTATTTGTTTGAGCAGTTGTAATTACAGCTGTACTTTTATTACTTTCATTGCCCGTACTTGCTGGTGCCATTACAATATTATTAACAGATCGAAATATTAATACATCATTTTTTGATCCTGCTGGAGGAGGAGATCCAATTTTATATCAACATTTATTT

CO1 Protein:

>AWX25063.1 cytochrome oxidase subunit I, partial (mitochondrion) [Gynacantha subinterrupta] 

LAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMKLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF

Copyright © 2020-2022, All Rights Reserved. Odonata of Bangladesh holds copyright for all the original material and compilations on this website, although contributing writers and photographers may hold copyright for their material. Material from this website can be used freely for educational, basic research and conservation purposes, provided that this website is acknowledged and properly cited as the source. Contact us to obtain prior permission for any other use.