Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Urothemis signata (Rambur, 1842) — Greater Crimson Glider
Male
.jpg){kind=link}
Male
Male
Male
Male
Female
.jpg){kind=link}
Female
Mating
.jpg){kind=link}
Mating
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Urothemis
- Species:
- Urothemis signata (Rambur, 1842)
- Common name:
- Greater Crimson Glider
- Global IUCN status:
- Least Concern
- Eco-system:
- Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- Rajshahi, Dhaka, Sylhet, Chittagong, Khulna, Barisal
- Global Distribution:
- Australia, Bangladesh, Brunei Darussalam, Cambodia, China, Hong Kong, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Distinguishing Feature:
- The open character of the venation, the stable, low nodal index, and the character of the basal marking in the hind-wing will serve to identify this species.
- Abdomen Size:
- Male: 27.5 mm
Female: 26 mm - Wing Size:
- Male: 35.5 mm
Female: 35 mm - Wing Spot:
- Male: Ochreous and pale yellowish
Female: Ochreous and pale yellowish - Eye Color:
- Male: Blood red above bluish grey beneath
Female: Brownish red
- Description:
- Urothemis signata is one of the common dragonflies of Bangladesh and widely distributed throughout the country.
- Male Description:
- The male is red in color, often seen perching on the shrubs associated to water bodies. Males can be distinguished by the black legs and the presence of discontinuous black dorsal markings. A yellow colored male was also sighted. However, whether the male is juvenile or it is another form could not be determined. It has been sighted in the SUST campus on February 2015. The males were perching on the plants, top of the small hills. The yellow male is similar to female, however they are devoid of the abdominal black ring. The legs are black, wings are transparent, amber spot in the hind wing base and black dorsal stripe in the segments 9-10 help to distinguish from similar species.
- Female Description:
- The females are yellow colored with black rings in the abdomen. They are quiet similar to yellow male, hence terminal abdominal segments are important to distinguish females from male.
- COI Gene:
>MG884812.1 Urothemis signata isolate AN-KRP-16 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial
ATTAGCAGGAGCTATTGCTCATGCAGGAGCTTCAGTAGACCTTACTATTTTCTCCTTACACTTGGCAGGTGTATCCTCTATTCTAGGAGCAATCAATTTTATTACAACAGTAATTAATATAAAATCTCCTGGAATAAGTCTAGATCAACTGCCTTTATTTGTATGAGCAGTAGTAATTACTGCTGTACTATTATTGCTATCACTACCTGTTTTGGCAGGGGCTATTACTATATTATTAACTGATCGAAATATTAACACCTCATTCTTTGATCCTGCAGGAGGGGGAGATCCAATCCTCTACCAACACTTATTT
- CO1 Protein:
>AWX25152.1 cytochrome oxidase subunit I, partial (mitochondrion) [Urothemis signata]
LAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMSLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF