Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Pseudagrion rubriceps (Selys, 1876) — Saffron-Faced Blue Dart
Female
Others
Others
Others
Others
Others
.jpg){kind=link}
Others
Male
Male
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Pseudagrion
- Species:
- Pseudagrion rubriceps (Selys, 1876)
- Common name:
- Saffron-Faced Blue Dart
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Common
- Flight Seasons:
- All year round
- Local Distribution:
- All over the country
- Global Distribution:
- Bangladesh, Cambodia, China, Hong Kong, India, Indonesia, Laos, Malaysia, Myanmar, Nepal, Pakistan, Philippines, Thailand
- Identification Key:
- Face, frons, and vertex bright reddish- orange or dark ochreous. Thorax golden green on dorsum, azure blue on sides, sparingly marked with black; never pruinosed; a narrow black humeral stripe present.
- Distinguishing Feature:
- The male is easily distinguished from all others by the brilliant reddish-orange face, from which it derives its name, and which is very conspicuous, even when the insect is on the wing. The female presents more difficulty, as the bifid mark on segment 9 resembles the female of P. indicum most closely, but this latter has the band on segment 9 complete from base to apex.
- Abdomen Size:
- Male: 29 mm
Female: 29 mm - Wing Size:
- Male: 20 mm
Female: 21 mm - Wing Spot:
- Male: Reddish brown
Female: Pale brown - Eye Color:
- Male: Olivaceous green above, orange on sides and below
Female: Dark blue above, azure blue below
- Description:
- This blue damselfly is an exquisite, marvellous and spectacular flying creature. Quite abundant in Bangladesh. They are often sighted at the edge of the ponds, paddy fields and lakes.
- COI Gene:
>MF358837.1 Pseudagrion rubriceps isolate Changsha.2 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial
ATTTATAACGTAGTAGTAACAGCACACGCTTTCGTAATAATTTTCTTTATAGTAATACCAATTATAATTGGTGGGTTTGGAAATTGATTAGTTCCTTTAATACTAGGAGCACCAGATATGGCATTTCCACGACTTAACAATATAAGATTTTGACTCTTACCTCCTTCACTAACATTACTGCTAGCAAGCAGTCTCGTGGAAAGAGGAGCAGGAACAGGATGAACTGTATACCCACCTCTGGCAGGGGCTATCGCGCATGCAGGAGGATCAGTAGATATTACCATCTTCTCCCTACATCTAGCTGGTGTATCATCAATCCTAGGGGCTATTAATTTTATTACCACAACAATTAATATAAAGTCACCCGGAATAAAAATAGATCAACTACCTTTATTTGTATGGGCTGTAGTTATTACAGCAGTATTGTTATTATTATCTCTTCCAGTATTAGCAGGGGCTATTACAATACTATTAACAGACCGAAATATTAATACATCATTCTTTGATCCAGCAGGAGGGGGAGACCCTATTTTATATCAACACTTATTC
- CO1 Protein:
>AVI01518.1 cytochrome oxidase subunit I, partial (mitochondrion) [Pseudagrion rubriceps]
IYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGAIAHAGGSVDITIFSLHLAGVSSILGAINFITTTINMKSPGMKMDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF