Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Orthetrum chrysis (Selys, 1891) — Brown-Backed Red Marsh Hawk
- Suborder:
- Anisoptera
- Family:
- Libellulidae
- Genus:
- Orthetrum
- Species:
- Orthetrum chrysis (Selys, 1891)
- Common name:
- Brown-Backed Red Marsh Hawk
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- All year round
- Local Distribution:
- Dhaka, Sylhet, Chittagong, Khulna
- Global Distribution:
- Brunei Darussalam, China, Hong Kong, India, Indonesia, Laos, Malaysia, Myanmar, Philippines, Singapore, Sri Lanka, Thailand, Vietnam
- Identification Key:
- Lamina of male genitalia with a tuft of stiff black bristles; basal spot in hind-wing small, extending only to first antenodal nervure and end of membrane.
- Distinguishing Feature:
- It resembles Grocothemis servilia and Rhodothemis rufa in general appearance, but the large lobe of the prothorax will serve to separate it from the first and the venation of the discoidal field of fore-wing from the second. The tuft of stiff black bristles on the lamina, so conspicuous when viewed in profile, will serve to distinguish it from O. testaceum.
- Abdomen Size:
- Male: 30.5 mm
Female: 27.5 mm - Wing Size:
- Male: 34.5 mm
Female: 33.5 mm - Wing Spot:
- Male: Dark reddish brown
Female: Bright ochreous with black markings - Eye Color:
- Male: Coffee brown above, bluish grey below
Female: Similar
- COI Gene:
>gi|697993038|dbj|AB860015.1| Orthetrum chrysis mitochondrial COI gene for cytochrome oxidase subunit 1, partial cds, isolate: OCHR1
ACTTGTACCTTTAATATTAGGTGCGCCAGACATGGCATTCCCTCGACTTAACAACATAAGATTTTGACTTCTTCCTCCATCATTTACCTTATTATTAGCAAGTAGTATAGTTGAAAGCGGTGCAGGAACAGGATGAACCGTTTATCCTCCTCTTGCAGGAGCAATCGCTCATGCTGGAGCATCTGTAGACTTAACAATTTTTTCATTACACCTCGCTGGTGTATCATCTATTCTAGGGGCTATCAACTTTATTACAACAGTAATTAATATAAAATCACCAGGAATAAAATTAGATCAACTACCTTTATTTGTATGAGCAGTAGTAATTACTGCTGTATTATTGCTCTTATCATTACCTGTACTTGCAGGAGCAATTACTATACTTTTAACAGACCGAAATATTAACACCTCCTTCTTCGATCCTGCTGGGGGAGGAGACCCTATCCTGTAT
- CO1 Protein:
>tr|A0A0A1G913|A0A0A1G913_9ODON Cytochrome c oxidase subunit 1 (Fragment) OS=Orthetrum chrysis GN=COI PE=3 SV=1
LVPLMLGAPDMAFPRLNNMSFWLLPPSFTLLLASSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTVINMKSPGMKLDQLPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILY