Odonata of Bangladesh
List of Species
- Anisoptera (57)
- Aeshnidae (6)
- Gomphidae (5)
- Libellulidae (45)
- Acisoma (1)
- Aethriamanta (1)
- Brachydiplax (3)
- Brachythemis (1)
- Bradinopyga (1)
- Camacinia (1)
- Cratilla (1)
- Crocothemis (1)
- Diplacodes (2)
- Hydrobasileus (1)
- Indothemis (2)
- Lathrecista (1)
- Lyriothemis (1)
- Macrodiplax (1)
- Neurothemis (3)
- Onychothemis (1)
- Orthetrum (7)
- Palpopleura (1)
- Pantala (1)
- Potamarcha (1)
- Rhodothemis (1)
- Rhyothemis (3)
- Tetrathemis (1)
- Tholymis (1)
- Tramea (2)
- Trithemis (3)
- Urothemis (1)
- Zyxomma (1)
- Macromiidae (1)
- Zygoptera (45)
Aciagrion pallidum (Selys, 1891) — Pale Slender Dartlet
Female
Male
Male
- Suborder:
- Zygoptera
- Family:
- Coenagrionidae
- Genus:
- Aciagrion
- Species:
- Aciagrion pallidum (Selys, 1891)
- Common name:
- Pale Slender Dartlet
- Global IUCN status:
- Least Concern
- Eco-system:
- Terrestrial, Freshwater
- Abundance:
- Uncommon
- Flight Seasons:
- October - February
- Local Distribution:
- Dhaka, Sylhet
- Global Distribution:
- Bangladesh, Cambodia, China, India, Laos, Myanmar, Nepal, Thailand, Vietnam
- Identification Key:
- Ground-color pale brown, without black markings on head and thorax; species found in dry grassy lands or dry deciduous forests or scrub jungle.
- Distinguishing Feature:
- Its color serves to distinguish it from all other species of the genus.
- Abdomen Size:
- Male: 31 mm
Female: 30 mm - Wing Size:
- Male: 18 mm
Female: 20 mm - Wing Spot:
- Male: Pale brown
Female: Pale brown - Eye Color:
- Male: Brown and creamy white at sides
Female: Pale brown
- Male Description:
- The male has azure blue thorax with brown antehumeral stripe. The wings are clear, legs whitish. Abdominal segments 1-2 are laterally, segments 3-7 are black with basal azure blue ring, segemnts 8-10 are blue.
- Female Description:
- The females are very shy and difficult to catch, they often perch in the shaded region of the forest. The females can be distinguished by their anal appendages. Thorax is bluish with dark brown antehumeral stripe, abdominal segments 1-7 are laterally grey and dorsally black, Segments 8-10 are grey.
- COI Gene:
>MH881303.1 Aciagrion pallidum isolate odocal62 cytochrome c oxidase I (COI) gene, partial cds; mitochondrial
CAGGATCCTTAATTGGAGATGATCAAATTTATAACGTAGTAGTAACTGCACACGCCTTTGTTATAATTTTCTTTATAGTTATACCAATTATAATTGGTGGATTTGGAAATTGACTGGTACCATTAATATTAGGTGCACCAGATATAGCTTTTCCTCGATTAAATAATATGAGATTTTGACTATTACCCCCATCATTAACCCTTCTATTAGCAAGAAGATTAGTAGAAAGAGGGGCCGGAACTGGTTGAACCGTTTATCCACCATTAGCTGGAGTAATTGCTCATGCCGGAGCATCGGTGGATTTAACTATTTTTTCCTTACATTTAGCTGGAGTGTCTTCAATTTTAGGGGCAATTAATTTCATTACAACAACTATTAATATAAAATCACCCGGTATAAATATAGATCAAATACCATTATTTGTGTGAGCTGTAGTTATTACAGCAGTTTTATTATTATTATCTTTACCAGTATTAGCAGGAGCTATTACCATATTATTAACTGACCGAAATATTAATACATCATTTTTTGATCCCGCAGGAGGGGGAGATCCAATTTTATATCAACATCTATTTTGATTTTTTGGTCACC
- CO1 Protein:
>QCP69108.1 cytochrome c oxidase I, partial (mitochondrion) [Aciagrion pallidum]
GSLIGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLASSLVESGAGTGWTVYPPLAGVIAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMNMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFGH